Diaphorobacter limosus: P4826_16300 Help Entry P4826_16300       CDS       T10112                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism dls  Diaphorobacter limosus Pathway dls01100   Metabolic pathways dls01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:dls00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     P4826_16300    00074 Mycolic acid biosynthesis     P4826_16300   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     P4826_16300 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  WOO31942 UniProt:  A0ABZ0J4A1 LinkDB All DBs Position complement(3397084..3397344) Genome browser AA seq 86 aa AA seqDB search MNLTTQVIRVLDEALGLQGRSAGFQRDTPLLGALPELDSMAVLALITGLENHFGITFSDE DLHGAVFATVGSLCDLVEQALAQQDT NT seq 261 nt NT seq  +upstreamnt  +downstreamnt atgaacctgaccacacaagtcatccgcgtacttgacgaagcccttggcctgcaaggccgc agcgctggctttcagcgcgatacgccgctgctcggcgctctgccagagctggactccatg gccgtgctggccctgatcaccggccttgagaaccattttggaatcaccttcagcgacgaa gacctgcacggcgcggtgtttgccaccgtgggcagcctctgcgacctggtggagcaggcg ctggcccagcaggacacatga

DBGET integrated database retrieval system