Diaphorobacter limosus: P4826_18990 Help Entry P4826_18990       CDS       T10112                                  Symbol acpP Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism dls  Diaphorobacter limosus Pathway dls01100   Metabolic pathways dls01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:dls00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     P4826_18990 (acpP)    00074 Mycolic acid biosynthesis     P4826_18990 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     P4826_18990 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 Ribosomal_L12_N Ribosomal_L50 Phage_terminase Motif Other DBs NCBI-ProteinID:  WOO32438 LinkDB All DBs Position 3946539..3946778 Genome browser AA seq 79 aa AA seqDB search MSDIEARVKKIIAEQLGVEESQVTNEKAFVADLGADSLDTVELVMALEDEFGIEIPDEDA EKITTVQNAIDYANTHQKA NT seq 240 nt NT seq  +upstreamnt  +downstreamnt atgagcgatatcgaagcacgtgtcaaaaaaatcattgccgaacaactcggcgtggaagag tctcaagtcaccaacgaaaaggccttcgtggctgatctgggtgccgactcgctggacacg gtggaactggtgatggcactggaagacgaattcggcatcgaaatccctgacgaagacgca gaaaagatcaccacggtgcaaaacgccatcgactacgccaacacgcaccaaaaggcctaa

DBGET integrated database retrieval system