Diospyros lotus (date-plum): 127796421 Help Entry 127796421         CDS       T10632                                  Name (RefSeq) SKP1-like protein 1A   KO K03094   S-phase kinase-associated protein 1 Organism dlt  Diospyros lotus (date-plum) Pathway dlt03083   Polycomb repressive complex dlt04120   Ubiquitin mediated proteolysis dlt04141   Protein processing in endoplasmic reticulum Brite KEGG Orthology (KO) [BR:dlt00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     127796421    04120 Ubiquitin mediated proteolysis     127796421   09126 Chromosome    03083 Polycomb repressive complex     127796421  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:dlt04131]     127796421    04121 Ubiquitin system [BR:dlt04121]     127796421    03036 Chromosome and associated proteins [BR:dlt03036]     127796421 Membrane trafficking [BR:dlt04131]  Endosome - Lysosome transport   Acidification regulators    RAVE complex     127796421 Ubiquitin system [BR:dlt04121]  Ubiquitin ligases (E3)   Multi subunit type E3    SCF complex     Adaptor protein      127796421    Cul7 complex      127796421 Chromosome and associated proteins [BR:dlt03036]  Eukaryotic type   Histone modification proteins    Polycomb repressive complex (PRC) and associated proteins     Noncanonical PRC1 (PRC1.1)      127796421   Centromeric chromatin formation proteins    Kinetochore proteins     CBF3 complex      127796421 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Skp1 Skp1_POZ BTB Motif Other DBs NCBI-GeneID:  127796421 NCBI-ProteinID:  XP_052184517 LinkDB All DBs Position 3:40027655..40028201 Genome browser AA seq 148 aa AA seqDB search MSEKKLKLKSSDGRIFTLEERAAVQSEMLKLMVEDNCAFGTIPMPNVDSRTLAMVIDFCK RHADPTGKTDLEAFDAQFVDKDQATLFDLLMAANYLNIPGLLDKLSGKIADMIKGKSPEE IRQIFNIKNDFTQKEEEEIRRENGWAFE NT seq 447 nt NT seq  +upstreamnt  +downstreamnt atgtctgagaagaagttgaagttgaagagctccgatggtcgcatattcacgctcgaagag cgagcagcggttcagtccgagatgttgaagctcatggtggaagacaattgtgcattcggc acgattccgatgccgaacgtcgactctaggacgctcgccatggtgatcgacttctgcaag cggcatgctgatccaacggggaaaactgatctcgaggcctttgacgcacaattcgtagac aaagaccaggcgacgttgttcgatctgttaatggccgcaaattatctaaatatcccaggg ttgttggataaactgtctgggaagatcgccgacatgatcaaggggaagtctccggaggag attcgacagatattcaacatcaagaacgatttcacgcaaaaagaagaggaggagattcgt agagagaatggctgggctttcgagtga

DBGET integrated database retrieval system