Diospyros lotus (date-plum): 127801982
Help
Entry
127801982 CDS
T10632
Name
(RefSeq) SKP1-like protein 1B
KO
K03094
S-phase kinase-associated protein 1
Organism
dlt Diospyros lotus (date-plum)
Pathway
dlt03083
Polycomb repressive complex
dlt04120
Ubiquitin mediated proteolysis
dlt04141
Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:
dlt00001
]
09120 Genetic Information Processing
09123 Folding, sorting and degradation
04141 Protein processing in endoplasmic reticulum
127801982
04120 Ubiquitin mediated proteolysis
127801982
09126 Chromosome
03083 Polycomb repressive complex
127801982
09180 Brite Hierarchies
09182 Protein families: genetic information processing
04131 Membrane trafficking [BR:
dlt04131
]
127801982
04121 Ubiquitin system [BR:
dlt04121
]
127801982
03036 Chromosome and associated proteins [BR:
dlt03036
]
127801982
Membrane trafficking [BR:
dlt04131
]
Endosome - Lysosome transport
Acidification regulators
RAVE complex
127801982
Ubiquitin system [BR:
dlt04121
]
Ubiquitin ligases (E3)
Multi subunit type E3
SCF complex
Adaptor protein
127801982
Cul7 complex
127801982
Chromosome and associated proteins [BR:
dlt03036
]
Eukaryotic type
Histone modification proteins
Polycomb repressive complex (PRC) and associated proteins
Noncanonical PRC1 (PRC1.1)
127801982
Centromeric chromatin formation proteins
Kinetochore proteins
CBF3 complex
127801982
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
Skp1_POZ
Skp1
Motif
Other DBs
NCBI-GeneID:
127801982
NCBI-ProteinID:
XP_052193532
LinkDB
All DBs
Position
5:complement(33883100..33894471)
Genome browser
AA seq
155 aa
AA seq
DB search
MSTSKMIVLKSSDGETFEVDESVAVESQTIKHMIEDNCADTVIPLPNVTSKILAKVIEYC
KRHVDAPKSEDKAAEEELKSFDAEFVKVDQATLFDLILAANYLNIKSLLDSTCQTVAEMI
KGKTPEEIRKTFNIKNDFTPDEEEEVRRENAWAFE
NT seq
468 nt
NT seq
+upstream
nt +downstream
nt
atgtcgacatcgaagatgatcgtgttgaagagctcggacggcgagaccttcgaggtggat
gagtcggtcgcggtggagtcacaaaccatcaagcacatgatcgaagataactgtgccgac
actgtcattcctttaccgaacgttacgagtaagatccttgcaaaggttatcgagtactgc
aagaggcacgttgatgcgcccaagtctgaagacaaggccgcggaggaagaactcaagagt
tttgatgccgagttcgtcaaagtggaccaggccacgctgttcgatcttatcctggcagcc
aattatcttaacattaagagcctgctggattcaacatgtcagacggtggctgagatgatc
aaggggaagactccggaggagattcgaaagaccttcaacatcaagaatgacttcactcct
gatgaagaagaagaggtccgcagggagaatgcgtgggcatttgagtag
DBGET
integrated database retrieval system