Diospyros lotus (date-plum): 127802593 Help Entry 127802593         CDS       T10632                                  Name (RefSeq) rac-like GTP-binding protein 5   KO K04392   Ras-related C3 botulinum toxin substrate 1 Organism dlt  Diospyros lotus (date-plum) Pathway dlt04145   Phagosome dlt04148   Efferocytosis dlt04620   Toll-like receptor signaling pathway dlt05100   Bacterial invasion of epithelial cells Brite KEGG Orthology (KO) [BR:dlt00001]  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     127802593    04148 Efferocytosis     127802593  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     127802593  09160 Human Diseases   09171 Infectious disease: bacterial    05100 Bacterial invasion of epithelial cells     127802593  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:dlt04131]     127802593   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:dlt04147]     127802593    04031 GTP-binding proteins [BR:dlt04031]     127802593 Membrane trafficking [BR:dlt04131]  Exocytosis   Small GTPases and associated proteins    Rho GTPases     127802593  Endocytosis   Lipid raft mediated endocytosis    Arf6-dependent endocytosis     127802593   Macropinocytosis    Ras GTPases     127802593  Others   NADPH oxidases (Nox) and associated proteins    Nox associated proteins     127802593 Exosome [BR:dlt04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    127802593   Exosomal proteins of other body fluids (saliva and urine)    127802593   Exosomal proteins of colorectal cancer cells    127802593   Exosomal proteins of bladder cancer cells    127802593 GTP-binding proteins [BR:dlt04031]  Small (monomeric) G-proteins   Rho Family    Rac/Cdc42 [OT]     127802593 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc GTP_EFTU Arf Sua5_C AAA_7 Motif Other DBs NCBI-GeneID:  127802593 NCBI-ProteinID:  XP_052194448 LinkDB All DBs Position 5:10815799..10820869 Genome browser AA seq 199 aa AA seqDB search MNTTTATKFIKCVTVGDGAVGKTCLLISYTSNTFPTDYVPTVFDNFSANVKVDGHTINLG LWDTAGQEDYNRLRPLSYRGADVFVLAFSLISRPSFENISKKWVPELRHYAPSVPIILVG TKLDLREDKQFQMNYPGASTISTAQGEELKKQIGAVAYVECSSKTQQNVKVVFDAAIKAV LQPPKSKRHRRKHKGCSIL NT seq 600 nt NT seq  +upstreamnt  +downstreamnt atgaatactaccaccgcaacaaagttcatcaaatgtgtcacagtgggagatggagccgtt gggaaaacttgccttctcatctcctacaccagcaacaccttccccactgattacgttcca actgtttttgacaacttcagtgccaatgtcaaggttgatgggcatactataaacctgggt ctttgggatactgctgggcaagaagattacaacaggctgaggcctcttagttatagagga gctgatgtttttgtccttgccttttctctaataagtaggccaagttttgaaaatatatcg aaaaagtgggtccctgaactaaggcattatgctccatcagtacccattattctagtgggg acaaaactagatttgagagaagacaagcaatttcaaatgaattatcctggtgcatctacc atttctacagcacagggtgaagaactaaagaagcaaattggagcagtggcatatgtagag tgtagctccaagacgcagcagaatgtgaaggttgtcttcgatgctgcaatcaaggcggtt ttgcagccgccaaagtccaagagacacaggagaaaacacaaaggctgcagcatactttaa

DBGET integrated database retrieval system