Diospyros lotus (date-plum): 127814224 Help Entry 127814224         CDS       T10632                                  Name (RefSeq) rac-like GTP-binding protein 5   KO K04392   Ras-related C3 botulinum toxin substrate 1 Organism dlt  Diospyros lotus (date-plum) Pathway dlt04145   Phagosome dlt04148   Efferocytosis dlt04517   IgSF CAM signaling dlt04518   Integrin signaling dlt04620   Toll-like receptor signaling pathway dlt05100   Bacterial invasion of epithelial cells Brite KEGG Orthology (KO) [BR:dlt00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04517 IgSF CAM signaling     127814224    04518 Integrin signaling     127814224  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     127814224    04148 Efferocytosis     127814224  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     127814224  09160 Human Diseases   09171 Infectious disease: bacterial    05100 Bacterial invasion of epithelial cells     127814224  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:dlt04131]     127814224   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:dlt04147]     127814224    04031 GTP-binding proteins [BR:dlt04031]     127814224 Membrane trafficking [BR:dlt04131]  Exocytosis   Small GTPases and associated proteins    Rho GTPases     127814224  Endocytosis   Lipid raft mediated endocytosis    Arf6-dependent endocytosis     127814224   Macropinocytosis    Ras GTPases     127814224  Others   NADPH oxidases (Nox) and associated proteins    Nox associated proteins     127814224 Exosome [BR:dlt04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    127814224   Exosomal proteins of other body fluids (saliva and urine)    127814224   Exosomal proteins of colorectal cancer cells    127814224   Exosomal proteins of bladder cancer cells    127814224 GTP-binding proteins [BR:dlt04031]  Small (monomeric) G-proteins   Rho Family    Rac/Cdc42 [OT]     127814224 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU Sua5_C AAA_7 Motif Other DBs NCBI-GeneID:  127814224 NCBI-ProteinID:  XP_052211549 LinkDB All DBs Position 12:34124560..34128714 Genome browser AA seq 199 aa AA seqDB search MATATRFIKCVTVGDGAVGKTCLLISYTSNTFPTDYVPTVFDNFSANVSVDGQNVNLGLW DTAGQEDYNRLRPLSYRGADAFLLSFSLISRPSFENILKKWVPELRHYAPSVPIVLVGTK LDLREDKQFQMDYPSACTISTEQGEELKKQMGAVAYVECSSKTQQNVKAVFDAAVKAVLR PPKPKGQTKKGQRKLCRIL NT seq 600 nt NT seq  +upstreamnt  +downstreamnt atggccaccgcaacaaggttcatcaaatgtgttacagttggggatggagctgttgggaaa acttgtcttctcatctcctacaccagcaacactttccccactgattatgtgccaactgtt tttgacaacttcagtgccaatgttagtgttgatggacagaatgtgaatctgggtctctgg gacactgctgggcaagaagactataacaggctgaggcctcttagttacagaggagctgat gccttcctcctttccttttctctcataagtaggcctagctttgagaacatattgaaaaaa tgggtccctgaacttagacattatgctccatcggtgcccattgttcttgtggggaccaaa ctagatttgagagaagataagcagttccaaatggactatcccagtgcatgtaccatttca accgaacagggcgaagaactcaagaagcagatgggagcggtggcatatgtagagtgcagc tccaagacacagcagaacgtcaaggccgtcttcgacgccgcggtcaaggcggttcttcgg cctccgaagcccaagggacagacgaagaaaggccagaggaaactctgccggatactttaa

DBGET integrated database retrieval system