Dehalogenimonas lykanthroporepellens: Dehly_0305 Help Entry Dehly_0305        CDS       T01264                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism dly  Dehalogenimonas lykanthroporepellens Pathway dly01100   Metabolic pathways dly01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:dly00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     Dehly_0305    00074 Mycolic acid biosynthesis     Dehly_0305   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     Dehly_0305 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Skp1_POZ ACP_SdgA_C DUF1493 Motif Other DBs NCBI-ProteinID:  ADJ25626 LinkDB All DBs Position 286644..286901 Genome browser AA seq 85 aa AA seqDB search MATIFERVKKIGIEQLGVEDKDVTMEASFTDDLGADSLDLVELIMALEEEFSTDDAKIEI PDEDAEKLLTVKDVVEYLKGKGVTD NT seq 258 nt NT seq  +upstreamnt  +downstreamnt atggccacaatttttgagcgcgtcaagaaaatcggcatcgaacagctcggcgtcgaggac aaggacgtcaccatggaagcctcgttcaccgatgacctgggcgccgattcactggacctg gtggaactgatcatggctctggaagaagagttttccactgatgacgccaagatcgagatt cccgacgaagacgcggagaaactgctgaccgtcaaggatgtcgtcgagtacctgaagggc aaaggcgttaccgactaa

DBGET integrated database retrieval system