KEGG   Solidesulfovibrio magneticus: DMR_12360
Entry
DMR_12360         CDS       T00917                                 
Symbol
rplR
Name
(GenBank) 50S ribosomal protein L18
  KO
K02881  large subunit ribosomal protein L18
Organism
dma  Solidesulfovibrio magneticus
Pathway
dma03010  Ribosome
Brite
KEGG Orthology (KO) [BR:dma00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    DMR_12360 (rplR)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:dma03011]
    DMR_12360 (rplR)
Ribosome [BR:dma03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    DMR_12360 (rplR)
  Bacteria
    DMR_12360 (rplR)
  Archaea
    DMR_12360 (rplR)
SSDB
Motif
Pfam: Ribosomal_L18p Ribosomal_L5e
Other DBs
NCBI-ProteinID: BAH74727
UniProt: C4XLY9
LinkDB
Position
1347838..1348197
AA seq 119 aa
MKMTKTLARARRKVRIRKKLSGTVERPRLVVYRSNRHIYAQVIDDLTGQTLVSSSSLTLL
RAGEAVKADKEAATMVGKDLAAKALERNIQAVVFDRNGYIYHGRVQALADGARDGGLKF
NT seq 360 nt   +upstreamnt  +downstreamnt
atgaagatgaccaagaccctggcgcgagcgcgccggaaagtccgcatccgcaagaaactg
tctggcaccgtcgaacgccccaggctcgtggtgtaccggtccaaccggcacatctacgcc
caggtgatcgacgacctgaccggacagaccctggtgtcctcctccagcctgacgcttttg
agggccggcgaggcggtcaaggccgacaaggaagcggcgaccatggtcggtaaagacctg
gccgccaaggcccttgaacgcaacatccaggccgttgtgtttgaccgcaacggttacatc
taccacggcagggtgcaagccctggccgacggagcgcgggatggcggcctcaaattctaa

DBGET integrated database retrieval system