Solidesulfovibrio magneticus: DMR_12360
Help
Entry
DMR_12360 CDS
T00917
Symbol
rplR
Name
(GenBank) 50S ribosomal protein L18
KO
K02881
large subunit ribosomal protein L18
Organism
dma
Solidesulfovibrio magneticus
Pathway
dma03010
Ribosome
Brite
KEGG Orthology (KO) [BR:
dma00001
]
09120 Genetic Information Processing
09122 Translation
03010 Ribosome
DMR_12360 (rplR)
09180 Brite Hierarchies
09182 Protein families: genetic information processing
03011 Ribosome [BR:
dma03011
]
DMR_12360 (rplR)
Ribosome [BR:
dma03011
]
Ribosomal proteins
Mitochondria/ Chloroplast
Large subunit
DMR_12360 (rplR)
Bacteria
DMR_12360 (rplR)
Archaea
DMR_12360 (rplR)
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
Ribosomal_L18p
Ribosomal_L5e
Motif
Other DBs
NCBI-ProteinID:
BAH74727
UniProt:
C4XLY9
LinkDB
All DBs
Position
1347838..1348197
Genome browser
AA seq
119 aa
AA seq
DB search
MKMTKTLARARRKVRIRKKLSGTVERPRLVVYRSNRHIYAQVIDDLTGQTLVSSSSLTLL
RAGEAVKADKEAATMVGKDLAAKALERNIQAVVFDRNGYIYHGRVQALADGARDGGLKF
NT seq
360 nt
NT seq
+upstream
nt +downstream
nt
atgaagatgaccaagaccctggcgcgagcgcgccggaaagtccgcatccgcaagaaactg
tctggcaccgtcgaacgccccaggctcgtggtgtaccggtccaaccggcacatctacgcc
caggtgatcgacgacctgaccggacagaccctggtgtcctcctccagcctgacgcttttg
agggccggcgaggcggtcaaggccgacaaggaagcggcgaccatggtcggtaaagacctg
gccgccaaggcccttgaacgcaacatccaggccgttgtgtttgaccgcaacggttacatc
taccacggcagggtgcaagccctggccgacggagcgcgggatggcggcctcaaattctaa
DBGET
integrated database retrieval system