Solidesulfovibrio magneticus: DMR_18760 Help Entry DMR_18760         CDS       T00917                                  Name (GenBank) ferredoxin   KO K00176   2-oxoglutarate ferredoxin oxidoreductase subunit delta [EC:1.2.7.3] Organism dma  Solidesulfovibrio magneticus Pathway dma00020   Citrate cycle (TCA cycle) dma00720   Other carbon fixation pathways dma01100   Metabolic pathways dma01110   Biosynthesis of secondary metabolites dma01120   Microbial metabolism in diverse environments dma01200   Carbon metabolism dma01210   2-Oxocarboxylic acid metabolism Brite KEGG Orthology (KO) [BR:dma00001]  09100 Metabolism   09101 Carbohydrate metabolism    00020 Citrate cycle (TCA cycle)     DMR_18760   09102 Energy metabolism    00720 Other carbon fixation pathways     DMR_18760 Enzymes [BR:dma01000]  1. Oxidoreductases   1.2  Acting on the aldehyde or oxo group of donors    1.2.7  With an iron-sulfur protein as acceptor     1.2.7.3  2-oxoglutarate synthase      DMR_18760 SSDB OrthologParalogGFIT Motif Pfam:  Fer4 Fer4_7 Fer4_2 Fer4_21 Fer4_10 Fer4_9 Fer4_4 Fer4_16 Fer4_6 Fer4_8 Fer4_17 LdpA_Fe-S-bd Fer4_13 Fer4_22 Fer4_15 FeS Motif Other DBs NCBI-ProteinID:  BAH75367 UniProt:  C4XQK2 LinkDB All DBs Position 2104363..2104689 Genome browser AA seq 108 aa AA seqDB search MIPTLFHRVTGHRKSESNMGRNRVVVYPDWCKGCGICAAFCPKKVFAVGQDGKARVVNEE ACVNCGFCEPHCPDFAVLVIPGETDQTPCPSETAQDPADQTAAKEVKP NT seq 327 nt NT seq  +upstreamnt  +downstreamnt atgattccgacactttttcaccgcgtaaccggccaccgcaaaagcgagtcgaacatggga cgcaatcgtgtcgttgtctatccggactggtgcaagggctgcggcatatgcgccgcgttt tgccccaagaaggtctttgccgtgggccaggacggcaaggcccgtgtcgtaaacgaggaa gcctgtgtcaactgcggtttttgcgaaccgcattgcccggatttcgccgttctggtcatc ccaggcgaaactgaccagacgccgtgtccgtcggaaacggcgcaagacccggccgatcaa accgccgccaaggaggtcaagccgtga

DBGET integrated database retrieval system