Deinococcus metallilatus: E5F05_08870 Help Entry E5F05_08870       CDS       T09847                                  Symbol acpP Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism dmb  Deinococcus metallilatus Pathway dmb01100   Metabolic pathways dmb01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:dmb00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     E5F05_08870 (acpP)    00074 Mycolic acid biosynthesis     E5F05_08870 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     E5F05_08870 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 Ribosomal_L12_N DUF7080 Motif Other DBs NCBI-ProteinID:  QBY08048 LinkDB All DBs Position 610214..610444 Genome browser AA seq 76 aa AA seqDB search MATFEDVKEVIVDKLGVDADKVTPDARFVEDLGADSLETVELIMGLEDRFGVSISDEDAE KIRTVQAAVDYIGSKQ NT seq 231 nt NT seq  +upstreamnt  +downstreamnt atggcgacatttgaagatgtgaaggaagtgatcgtcgacaagctcggcgtggacgcggac aaggtgacgccggacgcgcgcttcgtcgaggacctgggcgcggacagcctggaaaccgtc gagctgatcatggggctcgaagaccgcttcggggtcagcatcagcgacgaggacgcggaa aagatccgcaccgtgcaggccgccgtcgattacatcggctcgaagcagtaa

DBGET integrated database retrieval system