Deinococcus metallilatus: E5F05_15630 Help Entry E5F05_15630       CDS       T09847                                  Name (GenBank) glutaredoxin family protein   KO K18917   mycoredoxin [EC:1.20.4.3] Organism dmb  Deinococcus metallilatus Brite KEGG Orthology (KO) [BR:dmb00001]  09190 Not Included in Pathway or Brite   09191 Unclassified: metabolism    99980 Enzymes with EC numbers     E5F05_15630 Enzymes [BR:dmb01000]  1. Oxidoreductases   1.20  Acting on phosphorus or arsenic in donors    1.20.4  With disulfide as acceptor     1.20.4.3  mycoredoxin      E5F05_15630 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Glutaredoxin GST_N_3 GST_N_2 Thioredoxin_2 Thioredoxin_9 Glrx-like GST_N IU_nuc_hydro DUF7564 Motif Other DBs NCBI-ProteinID:  QBY09253 LinkDB All DBs Position complement(1985925..1986170) Genome browser AA seq 81 aa AA seqDB search MIKMYTTNWCPDCHAAKRALTSKGIPFEEVNIEQDEQAAEYVMSVNGGKRSVPTLVSGDV ARSLSGFRPQKLDAFLAEAGL NT seq 246 nt NT seq  +upstreamnt  +downstreamnt atgatcaagatgtacacgaccaactggtgccccgactgccacgccgccaagcgcgcgctg accagcaagggcatccccttcgaggaagtcaacatcgagcaggacgagcaggccgccgag tacgtgatgagcgtgaacggcgggaagcgcagcgtgcccaccctggtcagcggcgacgtg gcccgcagcctcagcggcttccggccccagaaactcgacgccttcctggccgaagccggg ctgtaa

DBGET integrated database retrieval system