Drosophila melanogaster (fruit fly): Dmel_CG10130 Help Entry Dmel_CG10130      CDS       T00030                                  Symbol Sec61beta Name (RefSeq) Sec61 beta subunit   KO K09481   protein transport protein SEC61 subunit beta Organism dme  Drosophila melanogaster (fruit fly) Pathway dme03060   Protein export dme04141   Protein processing in endoplasmic reticulum dme04145   Phagosome Brite KEGG Orthology (KO) [BR:dme00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03060 Protein export     Dmel_CG10130 (Sec61beta)    04141 Protein processing in endoplasmic reticulum     Dmel_CG10130 (Sec61beta)  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     Dmel_CG10130 (Sec61beta)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:dme04131]     Dmel_CG10130 (Sec61beta)   09183 Protein families: signaling and cellular processes    02044 Secretion system [BR:dme02044]     Dmel_CG10130 (Sec61beta) Membrane trafficking [BR:dme04131]  Endoplasmic reticulum (ER) - Golgi transport   Others    SEC61 complex     Dmel_CG10130 (Sec61beta) Secretion system [BR:dme02044]  Sec (secretion) system   Eukaryotic Sec-SRP protein    Dmel_CG10130 (Sec61beta) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Sec61_beta Motif Other DBs NCBI-GeneID:  46080 NCBI-ProteinID:  NP_652037 FlyBase:  FBgn0010638 UniProt:  Q7JZN0 LinkDB All DBs Position 2R Genome browser AA seq 100 aa AA seqDB search MPAPASSTSVGSGSRSPSKLSAPRSAGSGGGSTLKQRKTTTSTTAARSRAPGGAGTGGMW RFYTDDSPGIKVGPVPVLVMSLLFIASVFMLHIWGKYNRS NT seq 303 nt NT seq  +upstreamnt  +downstreamnt atgcccgctccagccagttcaacgtccgtgggcagcggatcgcgctcccccagcaaattg tcggcgccacgtagcgccggatccggaggcggcagcaccctgaagcagcgcaagaccacc accagcaccacagcggcccggagccgtgcacccggcggagccggaactggtggcatgtgg cgtttctacacggacgactcgcccggtatcaaagttggtcccgtacccgtgctggtcatg tcgctgctcttcatcgcttccgtcttcatgctgcacatttggggcaaatacaatcgttct taa

DBGET integrated database retrieval system