Drosophila melanogaster (fruit fly): Dmel_CG11001 Help Entry Dmel_CG11001      CDS       T00030                                  Symbol Fkbp12 Name (RefSeq) FK506-binding protein 12kD   KO K09568   FK506-binding protein 1 [EC:5.2.1.8] Organism dme  Drosophila melanogaster (fruit fly) Brite KEGG Orthology (KO) [BR:dme00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03110 Chaperones and folding catalysts [BR:dme03110]     Dmel_CG11001 (Fkbp12) Enzymes [BR:dme01000]  5. Isomerases   5.2  cis-trans-Isomerases    5.2.1  cis-trans Isomerases (only sub-subclass identified to date)     5.2.1.8  peptidylprolyl isomerase      Dmel_CG11001 (Fkbp12) Chaperones and folding catalysts [BR:dme03110]  Protein folding catalysts   Peptidyl prolyl isomerase    FKBP     Dmel_CG11001 (Fkbp12) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  FKBP_C PPIase_AIP Motif Other DBs NCBI-GeneID:  37214 NCBI-ProteinID:  NP_523792 FlyBase:  FBgn0013954 UniProt:  P48375 H0RN81 LinkDB All DBs Position 2R Genome browser AA seq 108 aa AA seqDB search MGVQVVPIAPGDGSTYPKNGQKVTVHYTGTLDDGTKFDSSRDRNKPFKFTIGKGEVIRGW DEGVAQLSVGQRAKLICSPDYAYGSRGHPGVIPPNSTLTFDVELLKVE NT seq 327 nt NT seq  +upstreamnt  +downstreamnt atgggcgtacaagtagttccaattgctcctggtgatggcagcacctatcccaagaatggc caaaaggtcacggtccactacaccggcaccctggacgatggcaccaagttcgattcgtcg cgcgaccgcaacaagccattcaagttcaccatcggcaagggcgaggtcatccgtggctgg gatgagggagttgcccagttgagcgtcggccagcgcgccaagctgatttgctcgccggac tatgcctacggtagccgtggccaccccggcgtcattccgcccaactccaccctcaccttc gacgtcgagctgctcaaggtcgaatag

DBGET integrated database retrieval system