Drosophila melanogaster (fruit fly): Dmel_CG11165 Help Entry Dmel_CG11165      CDS       T00030                                  Symbol azot Name (RefSeq) ahuizotl   KO K02183   calmodulin Organism dme  Drosophila melanogaster (fruit fly) Pathway dme04070   Phosphatidylinositol signaling system dme04745   Phototransduction - fly Brite KEGG Orthology (KO) [BR:dme00001]  09130 Environmental Information Processing   09132 Signal transduction    04070 Phosphatidylinositol signaling system     Dmel_CG11165 (azot)  09150 Organismal Systems   09157 Sensory system    04745 Phototransduction - fly     Dmel_CG11165 (azot)  09180 Brite Hierarchies   09181 Protein families: metabolism    01009 Protein phosphatases and associated proteins [BR:dme01009]     Dmel_CG11165 (azot)   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:dme04131]     Dmel_CG11165 (azot)    03036 Chromosome and associated proteins [BR:dme03036]     Dmel_CG11165 (azot)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:dme04147]     Dmel_CG11165 (azot) Protein phosphatases and associated proteins [BR:dme01009]  Protein serine/threonine phosphatases   Phosphoprotein phosphatases (PPPs)    Calcineurin (PPP3/ PP2B)     Regulatory subunits      Dmel_CG11165 (azot) Membrane trafficking [BR:dme04131]  Exocytosis   Small GTPases and associated proteins    Rab associated proteins     Dmel_CG11165 (azot) Chromosome and associated proteins [BR:dme03036]  Eukaryotic type   Centrosome formation proteins    Centrosome duplication proteins     Centriole replication proteins      Dmel_CG11165 (azot) Exosome [BR:dme04147]  Exosomal proteins   Exosomal proteins of colorectal cancer cells    Dmel_CG11165 (azot) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  EF-hand_7 EF-hand_1 EF-hand_8 EF-hand_6 EF-hand_9 EF-hand_5 AIF-1 EF_EFCAB10_C EH Caleosin SPARC_Ca_bdg DUF5580_M EFhand_Ca_insen FGAR-AT_linker SurA_N_3 EF-hand_14 SurA_N_2 DUF2789 PhetRS_B1 Motif Other DBs NCBI-GeneID:  35751 NCBI-ProteinID:  NP_610336 FlyBase:  FBgn0033238 UniProt:  Q7K049 LinkDB All DBs Position 2R Genome browser AA seq 148 aa AA seqDB search MEDISHEERVLILDTFRILDKDNEGAITSKEMAVVIRALGRQPNDAEVQSMINEVDSEGN GSIVAPEFCNVILRKMRDTNHEDELREAFRIFDKDNNGYITTTELKNVFTALGVKLSDDE LEEMIREYDLDQDNHLNYEEFVNMMTMR NT seq 447 nt NT seq  +upstreamnt  +downstreamnt atggaggatatttcgcatgaggagcgagtcctgatccttgacactttccgtattttggac aaggacaacgagggcgccataacatctaaagagatggcggtggtgattcgcgccctgggt cgccagcccaacgacgccgaggttcagtccatgatcaatgaggtggattcggagggaaac ggatccatcgtggctccggagttctgcaatgtgattctgcgcaagatgcgcgacaccaac catgaggacgagctgcgcgaagctttccgaattttcgacaaggataacaatggctacatt accaccaccgagctaaaaaatgtgttcaccgcgctgggcgtaaagctcagcgacgacgag ttggaagaaatgatacgcgagtacgacttggatcaggacaatcacttgaattacgaggag ttcgtcaacatgatgacaatgcgatag

DBGET integrated database retrieval system