KEGG   Drosophila melanogaster (fruit fly): Dmel_CG11561
Entry
Dmel_CG11561      CDS       T00030                                 

Gene name
smo
Definition
(RefSeq) smoothened
  KO
K06226  smoothened
Organism
dme  Drosophila melanogaster (fruit fly)
Pathway
dme04341  Hedgehog signaling pathway - fly
Brite
KEGG Orthology (KO) [BR:dme00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04341 Hedgehog signaling pathway - fly
    Dmel_CG11561 (smo)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:dme04030]
    Dmel_CG11561 (smo)
G protein-coupled receptors [BR:dme04030]
 Frizzled / Smoothened family
  Dmel_CG11561 (smo)
SSDB
Motif
Pfam: Frizzled Fz Penicillinase_R DUF373
Other DBs
NCBI-GeneID: 33196
NCBI-ProteinID: NP_523443
FlyBase: FBgn0003444
UniProt: P91682
LinkDB
Structure
PDB: 
2MAH

Position
2L
AA seq 1036 aa
MQYLNFPRMPNIMMFLEVAILCLWVVADASASSAKFGSTTPASAQQSDVELEPINGTLNY
RLYAKKGRDDKPWFDGLDSRHIQCVRRARCYPTSNATNTCFGSKLPYELSSLDLTDFHTE
KELNDKLNDYYALKHVPKCWAAIQPFLCAVFKPKCEKINGEDMVYLPSYEMCRITMEPCR
ILYNTTFFPKFLRCNETLFPTKCTNGARGMKFNGTGQCLSPLVPTDTSASYYPGIEGCGV
RCKDPLYTDDEHRQIHKLIGWAGSICLLSNLFVVSTFFIDWKNANKYPAVIVFYINLCFL
IACVGWLLQFTSGSREDIVCRKDGTLRHSEPTAGENLSCIVIFVLVYYFLTAGMVWFVFL
TYAWHWRAMGHVQDRIDKKGSYFHLVAWSLPLVLTITTMAFSEVDGNSIVGICFVGYINH
SMRAGLLLGPLCGVILIGGYFITRGMVMLFGLKHFANDIKSTSASNKIHLIIMRMGVCAL
LTLVFILVAIACHVTEFRHADEWAQSFRQFIICKISSVFEEKSSCRIENRPSVGVLQLHL
LCLFSSGIVMSTWCWTPSSIETWKRYIRKKCGKEVVEEVKMPKHKVIAQTWAKRKDFEDK
GRLSITLYNTHTDPVGLNFDVNDLNSSETNDISSTWAAYLPQCVKRRMALTGAATGNSSS
HGPRKNSLDSEISVSVRHVSVESRRNSVDSQVSVKIAEMKTKVASRSRGKHGGSSSNRRT
QRRRDYIAAATGKSSRRRESSTSVESQVIALKKTTYPNASHKVGVFAHHSSKKQHNYTSS
MKRRTANAGLDPSILNEFLQKNGDFIFPFLQNQDMSSSSEEDNSRASQKIQDLNVVVKQQ
EISEDDHDGIKIEELPNSKQVALENFLKNIKKSNESNSNRHSRNSARSQSKKSQKRHLKN
PAADLDFRKDCVKYRSNDSLSCSSEELDVALDVGSLLNSSFSGISMGKPHSRNSKTSCDV
GIQANPFELVPSYGEDELQQAMRLLNAASRQRTEAANEDFGGTELQGLLGHSHRHQREPT
FMSESDKLKMLLLPSK
NT seq 3111 nt   +upstreamnt  +downstreamnt
atgcagtacttaaactttccgcgcatgccaaacattatgatgttcctggaggttgcgatc
ttatgcctgtgggtggtcgcagacgcatcggccagttcggccaagttcggcagcacaacg
cccgcaagtgcgcagcagtcggatgtggaactggagcccatcaatgggactctcaattac
cgactgtacgccaagaagggcagggacgacaaaccctggtttgatggcctagacagcagg
cacatccagtgtgtccgacgtgcccgttgctaccccacctcgaacgcaaccaacacctgt
ttcggctcaaaattgccctatgagctgagcagcctagatctcaccgacttccacaccgaa
aaggagctgaacgataagctgaacgactactatgccctgaagcacgtgcccaaatgttgg
gcagctatacagccctttttgtgcgccgtctttaagccgaagtgtgaaaaaatcaacggc
gaggacatggtctacctgccatcttacgagatgtgccgaattaccatggaaccctgtcgc
attttgtacaacacgacgtttttcccaaaattccttcgctgcaacgaaacactctttccg
acgaaatgcacaaacggagcacgaggaatgaaattcaacggaactggccagtgtttaagt
cctttggttccgacagatacgtcagccagctattatcctggcatcgagggctgcggcgtg
cgatgcaaggatccactctataccgatgatgagcatcggcagatccacaaactgatcgga
tgggctggcagcatatgtcttctgtctaaccttttcgtggtgtccaccttcttcatcgac
tggaagaatgccaacaagtatccggcagtaattgtgttctacataaatctttgctttcta
attgcttgcgtcggctggttgcttcagtttacttctggctcgcgagaggacatagtatgt
cgtaaggatggaacacttcgccactcagagcctacagccggtgaaaatctttcttgcata
gtgatctttgtgctggtctattattttctcaccgctggaatggtttggtttgtgttcctc
acctacgcctggcattggagggccatgggccacgtccaagatcggatagataagaaaggt
tcctactttcacctcgtggcgtggtcactaccccttgtgcttaccattaccacgatggct
ttcagtgaggtggatggaaatagtattgtgggcatctgcttcgtaggctatatcaatcat
tctatgagggcaggactacttcttggtccgctctgcggggtcatcctcattggtggatac
ttcatcacccgcggcatggtgatgctttttggactgaaacacttcgctaatgacattaaa
tcaacttcggcgagcaacaaaatccatttgatcatcatgcgcatgggagtctgtgctctg
ctcactttagttttcatactagtggccattgcgtgccacgttacggagtttaggcatgca
gacgaatgggcccagagcttcagacagtttataatctgcaaaatttcttcagtttttgaa
gaaaagagttcctgtcgaattgaaaaccgacctagtgttggcgttcttcaattgcatttg
ctgtgtctatttagctctggaatcgtaatgtccacctggtgctggacaccttcttcaatt
gagacttggaagcgttatataaggaaaaagtgtggcaaagaggtggtcgaagaagtgaaa
atgccgaagcacaaggtcattgcccagacatgggccaagcgcaaggatttcgaggacaag
ggcaggctctccataacgctctacaacacccacacagatcccgtggggctcaacttcgat
gtgaacgatctgaactcttctgagacgaatgacatctcatcaacttgggctgcatacctc
ccgcagtgcgtaaaacgtcgcatggctttgacgggagcagcgacaggtaactcgtcaagc
catggaccgcgaaaaaattcattggattccgagataagtgtgagtgttcgacatgtttcc
gttgaatcccgcagaaattcggtggactcgcaggtatcagtgaaaatagctgaaatgaag
accaaagtggcgtccagatcaaggggaaaacacggaggctcttccagcaacagaagaacc
caaaggagaagggattatatagcagctgccactggaaaaagcagtaggagaagggaaagc
agtacttcagtggagtcgcaggtcatcgcgctcaagaaaacgacctatcccaatgctagt
cacaaagtgggcgtgtttgctcatcacagctccaagaaacaacacaattacaccagctcc
atgaagcgaaggactgctaatgccggattggatccctctattcttaatgaattcctgcag
aaaaatggcgattttatattcccattcctccaaaatcaagatatgagctctagttcggag
gaggataattccagagcatcccaaaagattcaggatcttaacgtggttgtaaagcagcag
gaaataagtgaggatgatcacgacggaataaagattgaagaactgccaaatagcaaacag
gtggcattggagaactttcttaaaaacataaaaaaatctaatgaatccaattctaaccga
cattcccgaaattccgcaagaagtcagtcaaaaaagtcccaaaagagacatctcaagaac
cctgctgctgatctagatttcaggaaggactgtgtaaagtatcggtctaatgactcactt
agctgctcctctgaagagctggatgtggctttggacgtaggaagccttcttaacagctct
ttttctggaatatccatgggcaaaccacatagtagaaacagcaaaaccagctgcgatgtg
ggcatacaggctaatcctttcgagctagttcccagttacggagaagacgaactgcagcag
gccatgcgactcctaaacgcagccagcagacaaagaactgaagcagccaatgaggatttc
ggaggaacggagctgcagggcttgttgggtcattcccatcggcatcaaagggagcccacg
tttatgagcgagtcggacaaactcaaaatgttattgctgccttcaaaatag

DBGET integrated database retrieval system