Drosophila melanogaster (fruit fly): Dmel_CG11942 Help Entry Dmel_CG11942      CDS       T00030                                  Symbol SkpE Name (RefSeq) SKP1-related E   KO K03094   S-phase kinase-associated protein 1 Organism dme  Drosophila melanogaster (fruit fly) Pathway dme03083   Polycomb repressive complex dme04120   Ubiquitin mediated proteolysis dme04141   Protein processing in endoplasmic reticulum dme04310   Wnt signaling pathway dme04341   Hedgehog signaling pathway - fly dme04350   TGF-beta signaling pathway Brite KEGG Orthology (KO) [BR:dme00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     Dmel_CG11942 (SkpE)    04120 Ubiquitin mediated proteolysis     Dmel_CG11942 (SkpE)   09126 Chromosome    03083 Polycomb repressive complex     Dmel_CG11942 (SkpE)  09130 Environmental Information Processing   09132 Signal transduction    04310 Wnt signaling pathway     Dmel_CG11942 (SkpE)    04341 Hedgehog signaling pathway - fly     Dmel_CG11942 (SkpE)    04350 TGF-beta signaling pathway     Dmel_CG11942 (SkpE)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:dme04131]     Dmel_CG11942 (SkpE)    04121 Ubiquitin system [BR:dme04121]     Dmel_CG11942 (SkpE)    03036 Chromosome and associated proteins [BR:dme03036]     Dmel_CG11942 (SkpE) Membrane trafficking [BR:dme04131]  Endosome - Lysosome transport   Acidification regulators    RAVE complex     Dmel_CG11942 (SkpE) Ubiquitin system [BR:dme04121]  Ubiquitin ligases (E3)   Multi subunit type E3    SCF complex     Adaptor protein      Dmel_CG11942 (SkpE)    Cul7 complex      Dmel_CG11942 (SkpE) Chromosome and associated proteins [BR:dme03036]  Eukaryotic type   Histone modification proteins    Polycomb repressive complex (PRC) and associated proteins     Noncanonical PRC1 (PRC1.1)      Dmel_CG11942 (SkpE)   Centromeric chromatin formation proteins    Kinetochore proteins     CBF3 complex      Dmel_CG11942 (SkpE) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Skp1 Skp1_POZ Myb_DNA-binding_7 Motif Other DBs NCBI-GeneID:  32997 NCBI-ProteinID:  NP_608359 FlyBase:  FBgn0031074 UniProt:  Q9VWC3 LinkDB All DBs Position X:complement(19823368..19824080) Genome browser AA seq 167 aa AA seqDB search MVTPTIKLESSEGVIFPTEVRVAMVSETIKTMLDHFAVQNDENAIVPLHSVSTFTLGKIL AWANHHKDDDDQSTEGEELKPRRPYAISPWDAIFLMVNSTTLLEIILAAKQLQIKGLLEL TYNVVANMIRGKTPEEIRFIFNIPEDVSPSVDGELRWKDLFLWPMDF NT seq 504 nt NT seq  +upstreamnt  +downstreamnt atggttactcccaccatcaagcttgagtcctcggaaggggtgatctttccgacggaagtc cgagtcgccatggtctccgaaaccatcaagaccatgttggatcactttgccgtgcagaac gacgagaatgccatcgtgcccctgcactcggtgagcacgttcaccctgggcaagattcta gcctgggccaatcaccacaaggacgatgatgatcagtcaacggagggtgaggagctgaag ccacgtcgcccatatgccatctccccatgggacgccatcttcttgatggtcaattcaacc accttgctcgaaatcatactggccgccaaacaactgcagatcaagggcctactggaactc acctacaatgtggtggccaatatgattaggggcaagactcccgaggagatccgcttcatc ttcaacattccggaagacgtctcgccatccgtggacggggagttgagatggaaagacctg tttttgtggcccatggatttctga

DBGET integrated database retrieval system