KEGG   Drosophila melanogaster (fruit fly): Dmel_CG12066
Entry
Dmel_CG12066      CDS       T00030                                 
Symbol
Pka-C2
Name
(RefSeq) protein kinase, cAMP-dependent, catalytic subunit 2, isoform B
  KO
K04345  protein kinase A [EC:2.7.11.11]
Organism
dme  Drosophila melanogaster (fruit fly)
Pathway
dme04140  Autophagy - animal
dme04213  Longevity regulating pathway - multiple species
dme04310  Wnt signaling pathway
dme04341  Hedgehog signaling pathway - fly
Brite
KEGG Orthology (KO) [BR:dme00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    Dmel_CG12066 (Pka-C2)
   04341 Hedgehog signaling pathway - fly
    Dmel_CG12066 (Pka-C2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    Dmel_CG12066 (Pka-C2)
 09150 Organismal Systems
  09149 Aging
   04213 Longevity regulating pathway - multiple species
    Dmel_CG12066 (Pka-C2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:dme01001]
    Dmel_CG12066 (Pka-C2)
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:dme03019]
    Dmel_CG12066 (Pka-C2)
   03036 Chromosome and associated proteins [BR:dme03036]
    Dmel_CG12066 (Pka-C2)
Enzymes [BR:dme01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.11  cAMP-dependent protein kinase
     Dmel_CG12066 (Pka-C2)
Protein kinases [BR:dme01001]
 Serine/threonine kinases: AGC group
  PKA family
   Dmel_CG12066 (Pka-C2)
Messenger RNA biogenesis [BR:dme03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   mRNA cycle factors
    Common to processing body (P body) and stress granule
     Dmel_CG12066 (Pka-C2)
Chromosome and associated proteins [BR:dme03036]
 Eukaryotic type
  Centrosome formation proteins
   Kinases and associated factors
    Dmel_CG12066 (Pka-C2)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kinase-like Kdo ABC1 Haspin_kinase Seadorna_VP7
Other DBs
NCBI-GeneID: 43644
NCBI-ProteinID: NP_733397
FlyBase: FBgn0000274
UniProt: P16911
LinkDB
Position
3R
AA seq 354 aa
MSQHTSQYVFNSKEDYNVILDNMSREFEERWNHQTQSPYTNLENYITRAVLGNGSFGTVM
LVREKSGKNYYAAKMMSKEDLVRLKQVAHVHNEKHVLNAARFPFLIYLVDSTKCFDYLYL
ILPLVNGGELFSYHRRVRKFNEKHARFYAAQVALALEYMHKMHLMYRDLKPENILLDQRG
YIKITDFGFTKRVDGRTSTLCGTPEYLAPEIVQLRPYNKSVDWWAFGILVYEFVAGRSPF
AIHNRDVILMYSKICICDYKMPSYFTSQLRSLVESLMQVDTSKRLGNSNDGSSDVKSHPW
FQGVDWFGILNQEVTAPYQPTISGAEDLSNFENFEFKDRYKSRINRHPELFANF
NT seq 1065 nt   +upstreamnt  +downstreamnt
atgagccagcacacttcgcagtacgttttcaactccaaggaagactacaacgtaatccta
gacaacatgagtcgcgagttcgaagagcggtggaatcaccagacccagtcgccctacacc
aatctggaaaactatataacccgggccgtcctcggcaacggaagtttcggcactgtgatg
ctggtcagggagaagagtggcaagaactactatgccgccaagatgatgagcaaggaggat
ctggtgcggctgaagcaggtggcccacgtacacaacgagaagcacgtcctgaacgccgcc
cgattcccgttcctcatctacctggtggactcgaccaagtgcttcgactatctctaccta
atcctcccgctggtcaatggaggagagctgttcagttaccatcgcagagttcgcaagttc
aacgagaagcacgccagattctatgccgcccaggtggcacttgctcttgagtatatgcac
aagatgcacctcatgtaccgtgatctgaagccggagaacattctgctcgatcagcgcggc
tatatcaaaataacggacttcggtttcactaagcgtgtggatggccgcacatcaacgctg
tgtggaaccccggaatacttggccccggagattgttcaactccggccctacaacaaatcg
gtggactggtgggcctttggtatcctagtgtacgagtttgtggcagggcggtctcccttt
gccattcacaatcgagatgtaatcctgatgtactccaagatctgcatatgcgactacaag
atgccctcatactttacgtcccagctgaggagccttgtcgagagcctcatgcaggtggac
acctcaaagcgtttaggaaactcgaacgacggctccagcgacgtgaagagtcatccgtgg
ttccagggcgtagattggtttggcattctcaaccaggaagtcaccgccccctaccagccc
accatttccggcgccgaagatctgtcgaacttcgagaacttcgagttcaaggatcggtac
aagtcccgaataaaccgccatcccgaattgtttgcgaatttttaa

KEGG   Drosophila melanogaster (fruit fly): Dmel_CG4379
Entry
Dmel_CG4379       CDS       T00030                                 
Symbol
Pka-C1
Name
(RefSeq) protein kinase, cAMP-dependent, catalytic subunit 1, isoform D
  KO
K04345  protein kinase A [EC:2.7.11.11]
Organism
dme  Drosophila melanogaster (fruit fly)
Pathway
dme04140  Autophagy - animal
dme04213  Longevity regulating pathway - multiple species
dme04310  Wnt signaling pathway
dme04341  Hedgehog signaling pathway - fly
Brite
KEGG Orthology (KO) [BR:dme00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    Dmel_CG4379 (Pka-C1)
   04341 Hedgehog signaling pathway - fly
    Dmel_CG4379 (Pka-C1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    Dmel_CG4379 (Pka-C1)
 09150 Organismal Systems
  09149 Aging
   04213 Longevity regulating pathway - multiple species
    Dmel_CG4379 (Pka-C1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:dme01001]
    Dmel_CG4379 (Pka-C1)
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:dme03019]
    Dmel_CG4379 (Pka-C1)
   03036 Chromosome and associated proteins [BR:dme03036]
    Dmel_CG4379 (Pka-C1)
Enzymes [BR:dme01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.11  cAMP-dependent protein kinase
     Dmel_CG4379 (Pka-C1)
Protein kinases [BR:dme01001]
 Serine/threonine kinases: AGC group
  PKA family
   Dmel_CG4379 (Pka-C1)
Messenger RNA biogenesis [BR:dme03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   mRNA cycle factors
    Common to processing body (P body) and stress granule
     Dmel_CG4379 (Pka-C1)
Chromosome and associated proteins [BR:dme03036]
 Eukaryotic type
  Centrosome formation proteins
   Kinases and associated factors
    Dmel_CG4379 (Pka-C1)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kinase-like ABC1 Pkinase_C Haspin_kinase
Other DBs
NCBI-GeneID: 34284
NCBI-ProteinID: NP_476977
FlyBase: FBgn0000273
UniProt: P12370
LinkDB
Position
2L
AA seq 353 aa
MGNNATTSNKKVDAAETVKEFLEQAKEEFEDKWRRNPTNTAALDDFERIKTLGTGSFGRV
MIVQHKPTKDYYAMKILDKQKVVKLKQVEHTLNEKRILQAIQFPFLVSLRYHFKDNSNLY
MVLEYVPGGEMFSHLRKVGRFSEPHSRFYAAQIVLAFEYLHYLDLIYRDLKPENLLIDSQ
GYLKVTDFGFAKRVKGRTWTLCGTPEYLAPEIILSKGYNKAVDWWALGVLVYEMAAGYPP
FFADQPIQIYEKIVSGKVRFPSHFGSDLKDLLRNLLQVDLTKRYGNLKAGVNDIKNQKWF
ASTDWIAIFQKKIEAPFIPRCKGPGDTSNFDDYEEEALRISSTEKCAKEFAEF
NT seq 1062 nt   +upstreamnt  +downstreamnt
atgggcaacaacgccaccacgtcgaataagaaggtcgatgccgccgagacggtgaaggag
ttcctcgagcaggccaaggaggagttcgaggacaagtggcgacgcaatccgaccaacacc
gccgccctcgatgacttcgaacggatcaagaccctgggcaccggctcctttggccgtgtc
atgatcgtccagcacaagcccacgaaagactattatgccatgaagatcctcgacaagcag
aaggtggtcaagctgaagcaggtggagcacacgctgaacgagaagcgaatcctgcaggcc
attcagttccccttcctcgtctcgctgcgctaccacttcaaggacaactccaacctttac
atggtgctggagtatgttcccggtggcgagatgttctcccacctgcgcaaggtgggccgc
ttctcggagccgcactcgcgcttctacgcggcgcaaatcgtgctggccttcgagtacctg
cactacttggacctcatctaccgtgatctgaagccggagaatctgctgattgactcgcag
ggctacctcaaggtgacggacttcggttttgccaagcgggtcaagggacgcacctggaca
ctgtgcggcacgcccgaatacctggccccggagatcattctgtccaagggctataacaag
gccgtggactggtgggcgttgggcgtactcgtctacgaaatggccgccggctatccgccg
ttctttgcggatcagccgattcagatctacgagaagatcgtctccggcaaggtgcgcttc
ccatcgcactttggctccgatctgaaggacctactgcgcaacctgctgcaggtggatctg
accaagcgctacggcaatctgaaggcgggcgtcaatgatattaagaaccagaagtggttc
gcctccaccgactggattgcgatcttccaaaagaaaatcgaggcgccgttcattccgcgg
tgtaagggtcccggcgacacgagcaatttcgatgactacgaggaggaggcgctgcggatc
tccagcaccgagaagtgtgccaaggagtttgctgaattctag

DBGET integrated database retrieval system