KEGG   Drosophila melanogaster (fruit fly): Dmel_CG12147
Entry
Dmel_CG12147      CDS       T00030                                 
Symbol
CG12147
Name
(RefSeq) uncharacterized protein
  KO
K08957  casein kinase 1, alpha [EC:2.7.11.1]
Organism
dme  Drosophila melanogaster (fruit fly)
Pathway
dme04310  Wnt signaling pathway
dme04341  Hedgehog signaling pathway - fly
Brite
KEGG Orthology (KO) [BR:dme00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    Dmel_CG12147 (CG12147)
   04341 Hedgehog signaling pathway - fly
    Dmel_CG12147 (CG12147)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:dme01001]
    Dmel_CG12147 (CG12147)
Enzymes [BR:dme01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     Dmel_CG12147 (CG12147)
Protein kinases [BR:dme01001]
 Serine/threonine kinases: CK1 group
  CK1 family [OT]
   Dmel_CG12147 (CG12147)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Pkinase_fungal APH ABC1 Kdo
Other DBs
NCBI-GeneID: 40651
NCBI-ProteinID: NP_649536
FlyBase: FBgn0037325
UniProt: Q7JWT4
LinkDB
Position
3R
AA seq 477 aa
MAEREKGRAKDDRRWQGRSDVHQSKPQIRKERRHPPQPNHPHEKDQRQDRRFSEEKQSLP
EIIVAGKYRLLKRIGNGSFGELFQAEGLKYHEKVAIKLESSTVKHPLLPREARIYGILQG
GLGIPHVKHYATEGAYNVMVMDLLGPTLEDLLNLCSRSFSMKTTLMLADQILARVELLHR
RCFIHRDIKPDNFLMGLNRHQTQVYMIDFGLAKKFYSLRTQKHIGYTENRDLVGTARYAS
VRAHYAEQSRRDDLESVGYLLLYFQRGRLPWQGIRAQSQAQKYEKIAEYKANIPLQQLCS
GLPVEFFMYLKYCRKLHFAEKPDYVYLQQLFKVLFRNQYKVCDFLFDWVVLKRESPEQQS
QQKGRERDRGGKRNVVVQKERHRNKDRDSDTQRCRIKNGGDLLEIEENESTTGEDPNEDK
PQKKHGKACSCSYHLQKKRLQDRDRRAPLMTERRILSGEQEQELELELRGSPQMPCL
NT seq 1434 nt   +upstreamnt  +downstreamnt
atggcggaacgggaaaaggggcgtgccaaggacgacagacgttggcaaggccgttccgat
gttcaccaatccaagccgcagatccgaaaggagcgccgccatccgccacagccaaatcat
cctcatgagaaggaccagcgacaagatcgtcggttctcagaggagaagcaatccctaccg
gaaattatagtggcgggaaagtaccgtttattgaagcgtattggaaacggatccttcggc
gaactattccaggccgagggcctcaagtaccacgagaaggtggccataaagctggagagc
tccacggtcaagcacccattgctgccacgcgaggccaggatctatggcatcctgcagggc
ggactgggcatcccgcatgtgaagcactatgccaccgagggggcgtacaatgtcatggtg
atggacctcctggggcccacgctggaggatctgctaaacctctgctcgcgctcctttagc
atgaagaccaccctgatgctggccgaccagatccttgcccgcgtggagctgctccaccgg
agatgctttatccaccgggacatcaagccggacaacttcctgatgggcctgaaccgccac
cagactcaggtgtacatgattgacttcggactggccaaaaagttctacagcctgcgcacc
cagaagcacatcggctacacggagaaccgggacctggtaggtacggcccggtacgccagt
gtgcgggcccattacgcggagcagagtcgtcgggatgacctagagtccgtgggctacctg
ctgctctacttccagcggggtcgtcttccctggcagggaatccgggcgcagtcgcaggcc
cagaagtacgagaagatagctgagtacaaggccaacatcccactccagcaactctgctcc
ggattgcctgtcgagttcttcatgtatctgaagtactgccgcaagctgcacttcgccgag
aagccggattacgtgtatctgcagcagctgttcaaggtgctcttccggaaccagtacaag
gtgtgtgacttcctcttcgactgggtcgttttgaagcgagagtcgccggagcaacaatcg
cagcaaaagggtagggaaagggacaggggtggaaaaaggaacgtggtggtgcagaaggag
aggcatcgaaacaaggatagggatagtgatacgcagaggtgtcgaattaagaatggggga
gatctgctcgagatcgaggaaaatgaaagtaccactggggaagacccaaacgaagataag
cctcaaaaaaagcatggcaaggcctgctcctgcagctaccacctccagaagaagcgcctc
caggatcgggataggagggcgcctctgatgaccgagcggaggatcctttcgggggagcag
gagcaggagctggagctggagctgcgggggtcccctcagatgccctgtctttga

KEGG   Drosophila melanogaster (fruit fly): Dmel_CG2028
Entry
Dmel_CG2028       CDS       T00030                                 
Symbol
CkIalpha
Name
(RefSeq) casein kinase ialpha, isoform D
  KO
K08957  casein kinase 1, alpha [EC:2.7.11.1]
Organism
dme  Drosophila melanogaster (fruit fly)
Pathway
dme04310  Wnt signaling pathway
dme04341  Hedgehog signaling pathway - fly
Brite
KEGG Orthology (KO) [BR:dme00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    Dmel_CG2028 (CkIalpha)
   04341 Hedgehog signaling pathway - fly
    Dmel_CG2028 (CkIalpha)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:dme01001]
    Dmel_CG2028 (CkIalpha)
Enzymes [BR:dme01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     Dmel_CG2028 (CkIalpha)
Protein kinases [BR:dme01001]
 Serine/threonine kinases: CK1 group
  CK1 family [OT]
   Dmel_CG2028 (CkIalpha)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Pkinase_fungal ABC1 APH
Other DBs
NCBI-GeneID: 32221
NCBI-ProteinID: NP_001162737
FlyBase: FBgn0015024
UniProt: P54367 E1JJI5
LinkDB
Position
X:12653626..12657834
AA seq 337 aa
MDKMRILKESRPEIIVGGKYRVIRKIGSGSFGDIYLGMSIQSGEEVAIKMESAHARHPQL
LYEAKLYRILSGGVGFPRIRHHGKEKNFNTLVMDLLGPSLEDLFNFCTRHFTIKTVLMLV
DQMIGRLEYIHLKCFIHRDIKPDNFLMGIGRHCNKLFLIDFGLAKKFRDPHTRHHIVYRE
DKNLTGTARYASINAHLGIEQSRRDDMESLGYVMMYFNRGVLPWQGMKANTKQQKYEKIS
EKKMSTPIEVLCKGSPAEFSMYLNYCRSLRFEEQPDYMYLRQLFRILFRTLNHQYDYIYD
WTMLKQKTHQGQPNPAILLEQLDKDKEKQNGKPLIAD
NT seq 1014 nt   +upstreamnt  +downstreamnt
atggacaagatgcggatattgaaggaaagtcgccccgagataatcgtcggtggcaaatat
cgggtgatcaggaagattggaagcggatcgtttggcgacatttacctgggcatgagcatc
cagagcggcgaagaagtggccatcaagatggagagcgcccacgcccgccatccgcagctg
ttgtacgaggccaagctgtaccgcattctgagcggcggcgttggattccctcgtatacgt
caccatggcaaggaaaagaacttcaacaccctggtcatggacctgctgggaccctcgctg
gaggatctgttcaatttctgtacgcgccatttcacaatcaaaacggttctgatgctcgtc
gaccagatgatcggacgcttggagtacatccatctcaagtgcttcatccatcgcgacatc
aagccggataacttcctaatgggcattggtcggcactgcaataagctgttcctgatcgat
ttcggtctggccaagaagttccgcgatccgcacacgcgccatcacatcgtttaccgcgag
gacaagaacctcaccggcactgcccgctatgcctcgatcaatgcccatctgggcatcgag
cagtcgcggcgtgacgacatggaatcgcttggatacgtgatgatgtacttcaatcgcggc
gtactgccatggcaaggcatgaaggccaacaccaagcagcagaaatacgagaagatctcc
gaaaagaagatgtccacgcccatcgaggtcctctgcaagggctcgccggccgagttctcc
atgtatctgaactattgtcgtagcctgcgcttcgaggagcagccagattacatgtaccta
cgtcaattgttccgcatactgttcagaacgctgaaccatcagtatgactacatctacgac
tggacaatgctgaagcagaagacccatcagggtcaacccaatccagctatactcttggag
caattggacaaggacaaggagaagcagaacggcaagcccctgatcgcggactaa

KEGG   Drosophila melanogaster (fruit fly): Dmel_CG2577
Entry
Dmel_CG2577       CDS       T00030                                 
Symbol
CG2577
Name
(RefSeq) uncharacterized protein
  KO
K08957  casein kinase 1, alpha [EC:2.7.11.1]
Organism
dme  Drosophila melanogaster (fruit fly)
Pathway
dme04310  Wnt signaling pathway
dme04341  Hedgehog signaling pathway - fly
Brite
KEGG Orthology (KO) [BR:dme00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    Dmel_CG2577 (CG2577)
   04341 Hedgehog signaling pathway - fly
    Dmel_CG2577 (CG2577)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:dme01001]
    Dmel_CG2577 (CG2577)
Enzymes [BR:dme01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     Dmel_CG2577 (CG2577)
Protein kinases [BR:dme01001]
 Serine/threonine kinases: CK1 group
  CK1 family [OT]
   Dmel_CG2577 (CG2577)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr ABC1 Pkinase_fungal APH Kdo
Other DBs
NCBI-GeneID: 32188
NCBI-ProteinID: NP_572794
FlyBase: FBgn0030384
UniProt: Q9VYN5
LinkDB
Position
X:12373118..12374448
AA seq 344 aa
MERLRSSQNREVRIGNYKVVRKIGCGSFGDIYLGIYIHSGERVAIKVESSKVRHPQLNYE
RRIYRALRPAHGLPRIRYFHKEEHYQAMVMDLLGPSLERLFQFCERAFTIKTVLLLAEQM
LRRVEYVHNRGFLHRDIKPDNFLMGLGTMSKQVYLIDFGLSKKYLDITTGVHIPYREERS
LTGTARYASIGAHAGVESARRDDMVAVGYVLMYFNRGSLPWQDLKASTKQQKYERIHEKK
ISVSIEVLCEGFPCEFTMYLNYCRGMGFYDKPNYDFICRMFRMLRNGLNLRPGLIYDWDM
LMMKFHNTQKNPGIGMRVFPPKQKEDDGISGEPIIKDEKCNFWP
NT seq 1035 nt   +upstreamnt  +downstreamnt
atggaacgactgcgctcctcccaaaaccgcgaagtgcgaatcggcaactataaggtggtg
cgcaagatcggctgtggatccttcggcgatatatatctgggcatctatatccacagtggg
gagcgggtggccatcaaggtggaaagcagcaaggtgcgccatccgcagctcaactacgag
aggcgaatctaccgcgccctgaggcccgcccacggtttgccaaggattaggtacttccac
aaggaggagcactaccaggcgatggttatggatctgcttggtccctcgctggagagactc
tttcagttctgcgaaagggcattcaccatcaagaccgttctgcttctggccgaacagatg
cttcgccgggtggagtatgtccataaccggggattcctgcaccgcgacatcaagccggat
aacttcctgatgggtctgggtaccatgtccaagcaagtgtacctcatcgatttcgggcta
tccaagaagtatctggacataaccactggtgtccatataccatatcgcgaggagcgttcc
ttgacgggaacagccaggtacgcctccattggcgcccatgccggcgtcgaatccgccaga
agggatgacatggtggccgttggctatgtccttatgtacttcaatcggggatcactgccg
tggcaggatttaaaggcgtccaccaagcagcagaaatatgaacgcatacatgagaaaaag
atctcggtaagcattgaggtactttgcgagggatttccctgcgagttcacaatgtactta
aactactgccgcggcatgggattctacgataagcccaactacgacttcatctgccgcatg
tttcggatgctgcggaatggtctcaatcttcggccgggtctcatctacgactgggacatg
ctgatgatgaagttccacaatactcagaaaaatcctggcattggaatgcgtgtatttcca
cctaaacagaaggaagatgatggtatcagcggtgagccgatcatcaaagatgagaagtgc
aacttctggccgtga

KEGG   Drosophila melanogaster (fruit fly): Dmel_CG7094
Entry
Dmel_CG7094       CDS       T00030                                 
Symbol
CG7094
Name
(RefSeq) uncharacterized protein
  KO
K08957  casein kinase 1, alpha [EC:2.7.11.1]
Organism
dme  Drosophila melanogaster (fruit fly)
Pathway
dme04310  Wnt signaling pathway
dme04341  Hedgehog signaling pathway - fly
Brite
KEGG Orthology (KO) [BR:dme00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    Dmel_CG7094 (CG7094)
   04341 Hedgehog signaling pathway - fly
    Dmel_CG7094 (CG7094)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:dme01001]
    Dmel_CG7094 (CG7094)
Enzymes [BR:dme01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     Dmel_CG7094 (CG7094)
Protein kinases [BR:dme01001]
 Serine/threonine kinases: CK1 group
  CK1 family [OT]
   Dmel_CG7094 (CG7094)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr ABC1 Pkinase_fungal APH Kdo
Other DBs
NCBI-GeneID: 35065
NCBI-ProteinID: NP_609851
FlyBase: FBgn0032650
UniProt: Q9VJC2
LinkDB
Position
2L
AA seq 390 aa
MAKQEATNGKVRNASLHLEKLLIGGKYRLVKPIGSGSFGDIYLGLSITDGSEVAIKVEKN
DAKYPQLIYEAKVYEQLARCPGFPTLLHYGCEKNYNAMVMDLLGPSLEELFNLCKRRFSL
KTVLMLTDQLLMRIECVHERGFIHRDIKPDNFLMGLDRHCNKLYLIDFGLSKRYKDIESE
IHIPYRTDRNLTGTVRYASINAQIGVEQSRRDDMESMSYCLMYFNLGKLPWQGITAANKK
QKYEKILEKKTSVTIAQLCKGFPSEFCLLMTYVRNLGFKEPPDHTYLRQIFRILFRSLNH
HYDYIYDWTALQQQKDQICRSREQILESEREEVRKRDGERGCEPQRDKERHKDLELDRLH
KTSTQQAKCSNGHLTNRYDRIGDGGISKRK
NT seq 1173 nt   +upstreamnt  +downstreamnt
atggcaaaacaagaagcaacaaatgggaaagttcgtaatgcatctcttcatctggagaag
ctgttgatcgggggaaaatatcggctggtaaagcccattgggtccgggtccttcggcgat
atatatctcggactaagcatcacggatggatccgaggtggccattaaggtggagaagaac
gatgccaagtacccgcagctgatatacgaggcgaaagtgtacgaacagctggcccgctgt
ccgggcttcccgactctacttcattatggatgcgagaagaactataatgccatggttatg
gacctattaggtccttccctagaagaactttttaacctctgcaaacgccgattctcgctg
aagaccgtactcatgttgacagaccagctgctaatgcgaattgagtgtgtccacgaacgt
gggttcattcatcgtgacattaaaccagataacttcctaatgggtctggatcgccactgc
aacaagctgtacctcatcgattttggcctgtccaagagatacaaggacatagagtcagag
attcatataccataccgcacggatcggaatctaactggtactgttcgctatgcctctata
aatgcacagataggcgttgagcaatcccgtcgggatgacatggagtccatgtcctattgt
ttgatgtacttcaatctgggaaagttaccctggcagggtattacggccgccaacaagaag
caaaagtacgagaagatattggagaaaaagacaagcgtcacgatcgctcagctctgcaaa
ggatttccctccgaattttgcctgcttatgacctatgtcaggaatcttggtttcaaggag
ccgccggatcacacttatcttcgccagatattccgcatacttttccgctcactgaatcat
cattacgactatatatatgactggactgccttgcagcagcaaaaggatcaaatctgccgc
agcagggaacagattctggaatcggaacgagaagaggtccgcaaacgggatggggaacgg
ggttgtgagcctcagcgggacaaggagcggcacaaggatttggagctggatcgactgcac
aaaacttccacccaacaggcaaagtgctctaatggacatctaacaaaccgatatgatcgc
attggcgatggaggcattagcaagcgaaagtaa

DBGET integrated database retrieval system