Drosophila melanogaster (fruit fly): Dmel_CG12363 Help Entry Dmel_CG12363      CDS       T00030                                  Symbol Dlc90F Name (RefSeq) dynein light chain 90F   KO K10420   dynein light chain Tctex-type 1/3 Organism dme  Drosophila melanogaster (fruit fly) Pathway dme04145   Phagocytosis dme04814   Motor proteins Brite KEGG Orthology (KO) [BR:dme00001]  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagocytosis     Dmel_CG12363 (Dlc90F)   09142 Cell motility    04814 Motor proteins     Dmel_CG12363 (Dlc90F)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    03037 Cilium and associated proteins [BR:dme03037]     Dmel_CG12363 (Dlc90F)    04812 Cytoskeleton proteins [BR:dme04812]     Dmel_CG12363 (Dlc90F) Cilium and associated proteins [BR:dme03037]  Motile cilia and associated proteins   Dynein arm    Dmel_CG12363 (Dlc90F) Cytoskeleton proteins [BR:dme04812]  Eukaryotic cytoskeleton proteins   Microtubules    Tubulin-binding proteins     Dyneins      Dmel_CG12363 (Dlc90F) SSDB OrthologParalogGFIT Motif Pfam:  Tctex-1 MCEL_GT_NTPase DUF6547 Fascin Motif Other DBs NCBI-GeneID:  42199 NCBI-ProteinID:  NP_477356 FlyBase:  FBgn0024432 UniProt:  Q94524 A0A1B2AIX7 Structure PDBPDBj LinkDB All DBs Position 3R Genome browser AA seq 111 aa AA seqDB search MDDSREESQFIVDDVSKTIKEAIETTIGGNAYQHDKVNNWTGQVVENCLTVLTKEQKPYK YIVTAMIMQKNGAGLHTASSCYWNNDTDGSCTVRWENKTMYCIVSVFGLAV NT seq 336 nt NT seq  +upstreamnt  +downstreamnt atggatgactcacgcgaagaaagccagttcattgtggacgacgtgagcaagacgattaaa gaggccatcgagacgaccatcggcggtaacgcctaccagcacgacaaggtgaacaactgg accggccaggtggtggagaactgcctgacggtgctcaccaaggagcagaagccctacaag tacattgtgaccgccatgatcatgcaaaagaacggtgctggactccacaccgccagctcc tgctactggaacaacgacaccgacggatcgtgcacagtacgctgggagaacaagaccatg tactgcatcgtttcggtcttcggactggccgtctag

DBGET integrated database retrieval system