KEGG   Drosophila melanogaster (fruit fly): Dmel_CG13030
Entry
Dmel_CG13030      CDS       T00030                                 
Symbol
sinah
Name
(RefSeq) sina homologue
  KO
K04506  E3 ubiquitin-protein ligase SIAH1 [EC:2.3.2.27]
Organism
dme  Drosophila melanogaster (fruit fly)
Pathway
dme04013  MAPK signaling pathway - fly
dme04120  Ubiquitin mediated proteolysis
dme04137  Mitophagy - animal
dme04310  Wnt signaling pathway
Brite
KEGG Orthology (KO) [BR:dme00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    Dmel_CG13030 (sinah)
 09130 Environmental Information Processing
  09132 Signal transduction
   04013 MAPK signaling pathway - fly
    Dmel_CG13030 (sinah)
   04310 Wnt signaling pathway
    Dmel_CG13030 (sinah)
 09140 Cellular Processes
  09141 Transport and catabolism
   04137 Mitophagy - animal
    Dmel_CG13030 (sinah)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:dme04121]
    Dmel_CG13030 (sinah)
Enzymes [BR:dme01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     Dmel_CG13030 (sinah)
Ubiquitin system [BR:dme04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   SINA (Seven in absentia) proteins
    Dmel_CG13030 (sinah)
SSDB
Motif
Pfam: Sina_ZnF Sina_TRAF Sina_RING zf-C3HC4_3 zf-RING_5
Other DBs
NCBI-GeneID: 39885
NCBI-ProteinID: NP_648927
FlyBase: FBgn0259794
UniProt: Q8T3Y0 B5RJD9
LinkDB
Position
3L
AA seq 351 aa
MSVRNSRPQLSWPERVSPQRTIDTPTASGEMLTRRQSAPALVVPPEETTHVVVVKRQSPD
AAAAGELVPSRRKDSVAVQSGIVATGPLDTTRSGARDDFLMALLECPVCFGYIMPPIMQC
PRGHLICSTCRSKLTICPVCRVFMTNIRSLAMEKVASKLIFPCKHSHFGCRARLSYAEKT
KHEEDCECRPYFCPYPDDKCSWQGPLRDVYQHLMSSHENVITMEGNDIIFLATNVNLEGA
LDWTMVQSCHGRHFLLSLEKINLGEDCQQYFTACRMIGSMKDAAEFVYNISLEAYNRTLR
WQSKPRSIRENFSSFTNADFLVLNKHTVELFSEDGNLALNVVIRKVEERTN
NT seq 1056 nt   +upstreamnt  +downstreamnt
atgtctgttcgcaactcacgcccccagttatcgtggccggagcgggtaagtccgcaaagg
actattgacactccaacggcatccggagaaatgttgactcgtcgtcaatcggcaccagcg
ttggtcgtgccgccggaggagaccacgcacgttgtggtggtcaagcggcaatccccggac
gcagccgctgccggagaactggtgccgtctaggcggaaggactcggtggctgtgcagtcg
ggaattgtggccactgggccattggacacaacacgcagtggtgcaagagacgattttcta
atggctttgctcgagtgcccggtgtgctttggctacataatgccgccaattatgcagtgc
ccgcgtggccacctcatctgctccacctgccgctcaaagttgaccatttgccccgtctgc
cgggtgttcatgaccaacatccgcagcctggcaatggagaaggtggcctccaagctgatc
tttccctgcaagcattcgcatttcggctgcagagcgcggctctcttacgcagagaagacc
aagcacgaggaggattgcgaatgccgtccgtacttctgcccgtatccggatgacaagtgc
tcctggcagggaccgttgagggacgtataccagcacctgatgagctcccacgagaacgtg
atcaccatggagggcaacgacatcatctttttggccaccaatgtgaatctggagggtgcc
ctcgactggacaatggtgcagtcctgccatgggcggcacttcctcctctcgctggagaag
atcaatttgggagaggactgtcagcagtacttcaccgcctgtcggatgatcggctccatg
aaggatgccgccgagttcgtgtataacatctccttggaggcctataatcgcactctccgc
tggcaatccaagccaagatcaatccgtgagaacttctcctcgttcaccaacgccgacttc
ctggtgctcaataagcacaccgtcgaactgttctctgaggacggtaatcttgccctgaac
gtggtcattaggaaggtggaggagcgtaccaactaa

KEGG   Drosophila melanogaster (fruit fly): Dmel_CG9949
Entry
Dmel_CG9949       CDS       T00030                                 
Symbol
sina
Name
(RefSeq) seven in absentia, isoform C
  KO
K04506  E3 ubiquitin-protein ligase SIAH1 [EC:2.3.2.27]
Organism
dme  Drosophila melanogaster (fruit fly)
Pathway
dme04013  MAPK signaling pathway - fly
dme04120  Ubiquitin mediated proteolysis
dme04137  Mitophagy - animal
dme04310  Wnt signaling pathway
Brite
KEGG Orthology (KO) [BR:dme00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    Dmel_CG9949 (sina)
 09130 Environmental Information Processing
  09132 Signal transduction
   04013 MAPK signaling pathway - fly
    Dmel_CG9949 (sina)
   04310 Wnt signaling pathway
    Dmel_CG9949 (sina)
 09140 Cellular Processes
  09141 Transport and catabolism
   04137 Mitophagy - animal
    Dmel_CG9949 (sina)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:dme04121]
    Dmel_CG9949 (sina)
Enzymes [BR:dme01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     Dmel_CG9949 (sina)
Ubiquitin system [BR:dme04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   SINA (Seven in absentia) proteins
    Dmel_CG9949 (sina)
SSDB
Motif
Pfam: Sina_TRAF Sina_ZnF Sina_RING
Other DBs
NCBI-GeneID: 39884
NCBI-ProteinID: NP_001287089
FlyBase: FBgn0003410
UniProt: P21461 X2JB60
LinkDB
Position
3L
AA seq 314 aa
MSNKINPKRREPTAAAAGAGATGVATNTSTSTGSSSAGNTSSANTSSSSSSSLSSAGGGD
AGMSADLTSLFECPVCFDYVLPPILQCSSGHLVCVSCRSKLTCCPTCRGPLANIRNLAME
KVASNVKFPCKHSGYGCTASLVYTEKTEHEETCECRPYLCPCPGASCKWQGPLDLVMQHL
MMSHKSITTLQGEDIVFLATDINLPGAVDWVMMQSCFGHHFMLVLEKQEKYDGHQQFFAI
VQLIGSRKEAENFVYRLELNGNRRRLTWEAMPRSIHEGVASAIHNSDCLVFDTSIAQLFA
DNGNLGINVTISLV
NT seq 945 nt   +upstreamnt  +downstreamnt
atgtccaataaaatcaacccgaagcgccgcgaaccgacagcagcagcagcaggagccggt
gccacgggagtggccaccaacacgagcacctcgaccggatcctccagtgccggcaacacg
tcctcggccaacacatcctcgtcgtccagctcctcgctgtcgtccgccggtggcggtgat
gcgggcatgtccgccgacttgacctcgctgtttgaatgccccgtgtgctttgactatgtg
ctaccgccgatcctgcagtgctccagcgggcacctggtgtgcgtgtcctgtcgctccaag
ctcacctgctgccccacctgccgcggtccgctggcgaatatccgcaacctggcgatggag
aaggttgcctcgaacgtcaagttcccgtgcaagcactccggctacggatgcaccgcctcg
ctggtttacacggaaaagacagaacacgaggagacgtgcgagtgccggccctacctgtgt
ccgtgcccgggcgccagctgtaagtggcagggcccgcttgacctagtcatgcagcatctg
atgatgtcgcacaagagcatcacaacgctgcagggcgaggacatcgtgttcctggccacc
gacatcaacctgcccggcgccgtcgattgggtaatgatgcagtcctgcttcggccaccat
tttatgctcgtgctggagaagcaggagaagtacgacggacaccagcagttctttgccatc
gttcagctgatcgggtcgcgcaaggaagcggagaactttgtctatcgcctggagttgaac
ggaaaccgacgccggctcacctgggaggcaatgccgcgttcgatccacgagggcgtcgct
tccgcaattcacaactcggactgcctggtgttcgacacgtcgattgcgcaattgttcgcc
gacaatggcaacctgggcattaacgtgaccatatctctggtctaa

DBGET integrated database retrieval system