Drosophila melanogaster (fruit fly): Dmel_CG13202 Help Entry Dmel_CG13202      CDS       T00030                                  Symbol CG13202 Name (RefSeq) uncharacterized protein   KO K23731   coiled-coil domain-containing protein 103 Organism dme  Drosophila melanogaster (fruit fly) Brite KEGG Orthology (KO) [BR:dme00001]  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    03037 Cilium and associated proteins [BR:dme03037]     Dmel_CG13202 (CG13202)    04990 Domain-containing proteins not elsewhere classified [BR:dme04990]     Dmel_CG13202 (CG13202) Cilium and associated proteins [BR:dme03037]  Motile cilia and associated proteins   Other motile cilia associated proteins    Dmel_CG13202 (CG13202) Domain-containing proteins not elsewhere classified [BR:dme04990]  Other domain-containing proteins   Others    Dmel_CG13202 (CG13202) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Dynein_attach_N NMDAR2_C Motif Other DBs NCBI-GeneID:  36222 NCBI-ProteinID:  NP_610675 FlyBase:  FBgn0033623 UniProt:  A1Z8J9 LinkDB All DBs Position 2R Genome browser AA seq 81 aa AA seqDB search MDNWKITAEELIRLRESCLQCIRDGELYELRNDAKLRAVYSTQNYEEFKNIVDAAHLRPV TKGDKANFKTKNRLWNSAARD NT seq 246 nt NT seq  +upstreamnt  +downstreamnt atggataactggaagataaccgcggaggagcttatccgtctgcgggagagctgcttgcag tgcatccgtgatggagaactctatgaactgcgcaacgatgccaaacttagggctgtttat agcactcagaactacgaagaattcaagaacatagtggatgcggctcatcttcgtccagtg accaagggcgacaaggcgaattttaagacgaagaatcgactatggaactcggcggcccgg gattaa

DBGET integrated database retrieval system