KEGG   Drosophila melanogaster (fruit fly): Dmel_CG14164
Entry
Dmel_CG14164      CDS       T00030                                 
Symbol
Hez
Name
(RefSeq) hezron, isoform B
  KO
K23643  protein LSM12
Organism
dme  Drosophila melanogaster (fruit fly)
Pathway
dme04711  Circadian rhythm - fly
Brite
KEGG Orthology (KO) [BR:dme00001]
 09150 Organismal Systems
  09159 Environmental adaptation
   04711 Circadian rhythm - fly
    Dmel_CG14164 (Hez)
SSDB
Motif
Pfam: AD
Other DBs
NCBI-GeneID: 39167
NCBI-ProteinID: NP_001097566
FlyBase: FBgn0036057
UniProt: Q9VT67
LinkDB
Position
3L
AA seq 186 aa
MSSLAPCFTVGSIVRCKTCFGDNISGEVVAFDLGVKMLIMKCPSSNGGGDEQTTCNVTIV
NLSLCMDIEIVKEAIPPAEVQQPEPIDLPMIRERYRYATEHRTLSCRSYHPNASPFGQAL
FRLLVKRFGDPAIIWQNKGDQVAINILRQVVIDAPYATENIRYLDWNPKLAICVQEVVQN
FCSKQF
NT seq 561 nt   +upstreamnt  +downstreamnt
atgtcatcattggctccttgctttactgtgggctctattgtgcgctgcaagacttgtttt
ggcgacaacatttcgggcgaggttgtggccttcgatctgggcgtgaaaatgctgataatg
aagtgtccatcaagcaatggcggtggcgacgaacagaccacttgcaatgtgaccattgtg
aacctatccctgtgcatggacattgaaatagtaaaggaagcaattccgccggctgaagtt
caacagccagaaccgattgatttgcccatgatccgagaacgataccgatacgcaaccgaa
catcgtacgctctcctgccggagctatcatcccaatgcctcgccctttggtcaagctctg
ttcagactgttagtcaagcgattcggtgatcccgctatcatctggcagaacaaaggcgac
caagtggcgatcaatatactccgtcaggtggtcatcgatgcgccgtatgccacggagaat
atccgatacctcgattggaatcccaagctggcgatatgcgtccaagaggtcgttcaaaac
ttttgcagtaaacaattctag

KEGG   Drosophila melanogaster (fruit fly): Dmel_CG15735
Entry
Dmel_CG15735      CDS       T00030                                 
Symbol
Lsm12a
Name
(RefSeq) LSM12 homolog a
  KO
K23643  protein LSM12
Organism
dme  Drosophila melanogaster (fruit fly)
Pathway
dme04711  Circadian rhythm - fly
Brite
KEGG Orthology (KO) [BR:dme00001]
 09150 Organismal Systems
  09159 Environmental adaptation
   04711 Circadian rhythm - fly
    Dmel_CG15735 (Lsm12a)
SSDB
Motif
Pfam: AD Peptidase_S26
Other DBs
NCBI-GeneID: 32167
NCBI-ProteinID: NP_572777
FlyBase: FBgn0030364
UniProt: Q9VYR0
LinkDB
Position
X:12018640..12020719
AA seq 217 aa
MAAAAASAVNAVNDCFSIGSTVVCTTCFNEEVEGEVLAFDHNTKMLILKCRSKSTEELSD
IYAMNLSLCSNVQVIKECNGNFDDPQKLNLEQVKMRLRKTVERRQDYLKSKNADVSPEAQ
ELYRAIAKQYGYNEVSWQGLNIQILNEVTISPPYRVDNVVSSSNNETSCNYIKRIIKQFF
NTRPSPVPESGAAASTSSPSVSPTSSSLASGSPVPAN
NT seq 654 nt   +upstreamnt  +downstreamnt
atggccgctgccgctgcgagcgcagtgaatgcagtgaacgactgcttcagcatcggatcc
acagtcgtctgtacgacctgtttcaacgaggaggtggagggcgaggtgctggccttcgat
cacaacacaaagatgcttatcctgaaatgccgatccaagtccacggaggagctgagtgat
atctacgcgatgaacctctcgctctgcagcaacgtgcaggtgatcaaggagtgcaacggc
aactttgatgatccgcaaaagcttaatctggaacaggtcaaaatgcgtctgaggaaaaca
gttgagcgaagacaggactacttgaagtctaagaatgctgatgtcagtccagaggcgcag
gaactctatagagcgatagccaaacaatacgggtacaatgaagtctcctggcaaggactt
aacatacagatcctaaatgaagtcaccatctcgccgccgtaccgagtggacaacgtggtg
tccagctcgaacaacgaaacttcatgcaactacatcaagcgcatcatcaaacagttcttc
aacacgaggccatcgcccgtcccggaaagcggagctgcggccagcacctcgtcaccatcg
gtgtctcccacgtcctcatctcttgcatctggatcgccggttcccgcaaactaa

DBGET integrated database retrieval system