Drosophila melanogaster (fruit fly): Dmel_CG14612 Help Entry Dmel_CG14612      CDS       T00030                                  Symbol e(y)2b Name (RefSeq) enhancer of yellow 2b, isoform B   KO K11368   enhancer of yellow 2 transcription factor Organism dme  Drosophila melanogaster (fruit fly) Brite KEGG Orthology (KO) [BR:dme00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03021 Transcription machinery [BR:dme03021]     Dmel_CG14612 (e(y)2b)    03019 Messenger RNA biogenesis [BR:dme03019]     Dmel_CG14612 (e(y)2b)    03036 Chromosome and associated proteins [BR:dme03036]     Dmel_CG14612 (e(y)2b) Transcription machinery [BR:dme03021]  Eukaryotic type   RNA polymerase II system    Coactivators     SAGA/TFTC/STAGA complex      Dmel_CG14612 (e(y)2b) Messenger RNA biogenesis [BR:dme03019]  Eukaryotic type   mRNA surveillance and transport factors    Transport factors     TREX-2 complex      Dmel_CG14612 (e(y)2b) Chromosome and associated proteins [BR:dme03036]  Eukaryotic type   Histone modification proteins    HAT complexes     SAGA complex      Dmel_CG14612 (e(y)2b)     SLIK complex      Dmel_CG14612 (e(y)2b) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  EnY2 Motif Other DBs NCBI-GeneID:  50143 NCBI-ProteinID:  NP_001287204 FlyBase:  FBgn0040670 UniProt:  Q9VI60 A0A0B4LGS3 LinkDB All DBs Position 3R:7093935..7094727 Genome browser AA seq 95 aa AA seqDB search MTINKETGTDPDPGYKPTLRSQDKAALKELLHTRLVECGWHKDIKEMIRNIIMERGVDNI NRDQLAAQIVPQARALVPEVVKNEMMLRVHAALDK NT seq 288 nt NT seq  +upstreamnt  +downstreamnt atgacaataaacaaggaaacgggaaccgatcccgatcctggatataagcctacgttacgc agtcaagataaggccgccctgaaggaactgctgcacacgcgtcttgtggagtgcggatgg cacaaggacattaaggaaatgatacgaaacatcatcatggagcgcggagtggacaatata aaccgcgaccaactggctgcccaaatagtcccgcaagctcgcgctttggtgcctgaagtc gtcaaaaatgagatgatgctgcgcgtgcacgccgccctcgataagtag

DBGET integrated database retrieval system