KEGG   Drosophila melanogaster (fruit fly): Dmel_CG15365
Entry
Dmel_CG15365      CDS       T00030                                 
Symbol
CG15365
Name
(RefSeq) uncharacterized protein, isoform B
  KO
K26471  leucine zipper putative tumor suppressor 2
Organism
dme  Drosophila melanogaster (fruit fly)
Pathway
dme04310  Wnt signaling pathway
Brite
KEGG Orthology (KO) [BR:dme00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    Dmel_CG15365 (CG15365)
SSDB
Motif
Pfam: Fez1 MDM10 Exonuc_VII_L
Other DBs
NCBI-GeneID: 31829
NCBI-ProteinID: NP_001285030
FlyBase: FBgn0030077
UniProt: X2JD14
LinkDB
Position
X:complement(9054698..9067983)
AA seq 828 aa
MSAATHMAMPAHAVVPPPGTPPVLGGSGCSNLSLPSGKRGHKRSVSLENNAPLALRSTPS
MGQSSLGSPLLQFGQAAPGQGHSQGFHTGTLKSRQEQRRLSQKFGSHSNLDDEGVGIGVG
MGMGMGLQMRSKFQNIRQMFELSRSCVGGGGGDGRGGAAEEEAMQSLPATLPQQHQQQQQ
RRTTPIAGGSRHQQQQQMGEAEQTSGNFLRPIAFKPIPFEPDYRIACQQQQQHQQQLQLQ
QQQQQQQQQQQQQQLQLQHQQQQQHQQQHQHQHQQQHQSLQLPTEGGQAGGVAAERYGYG
STPSLAPLPTASAQKFGSTTDLRHLAARRRNHRLLQRCSNEDALTLDLLSTGSHDRPDGA
SSKSSGTVVGSSDLTPSPSDSGISELEAALKDRDSELSYLRQAMEHNEKVIFQVQKDKEV
YWEHETQRLRLFYEGQQRECQLKLRKMEQLLGLQQFQLKQHKLRQSEQVNRLQQQLDLAR
DSSQGLQQQVDALRHQLEDSEWRVCERNGEIALLKTQLKEAHLEINMKDHAIVSLKHSSN
RSSSSSNSNSNKSCDTNTSQSQPKQQAKEEQQQQQHPELQQQQQQQQQQQQQQQQQQQQQ
QQQQQQQQQQQQQQQQLKQQHQPDQQQLQKIITLKDQVIGALTSELAKLRKELSDLAIAH
EYGEEPCGRYTRLKQQLDNLNEICQKTRKYTTTSASPTAVASPAAQVAPPAPSPAAHVAT
PSCAQELPKLDVLVQRLQLDQGQGTQQTLDTLIEESTTYAEDIAKLRQKLDDFRLNLELE
KRQWSAEKDKVLGYQKQLQAHYIQMYQKLRCLDSAGAAVGQVEATSGN
NT seq 2487 nt   +upstreamnt  +downstreamnt
atgtcggctgccacgcacatggcaatgccggctcacgccgtcgtcccgccgcccggcaca
ccgccggtgctggggggcagtgggtgctccaatcttagcctgccgtcgggcaagcgtggc
cacaagcgcagcgtttcgctggagaataatgcaccactggcactgcgcagcacacctagc
atgggtcaatcctcgctgggctcgccgctgctgcaatttggccaggctgcgcctgggcaa
ggacactcgcagggctttcacacgggcacattgaagtcgcgccaggagcagcgtcgtctg
agccaaaagttcgggagtcacagcaacttggatgatgagggtgtgggcattggcgtgggc
atgggcatgggcatgggcctgcagatgcgcagcaagttccagaatatacgacaaatgttc
gagctgagtcgcagttgtgtgggcggcgggggcggcgatggcagagggggcgcggccgag
gaggaggcaatgcaatctctgccagcaacattgccgcagcaacatcagcagcagcagcag
aggcgcaccacgcccattgccggcggaagtcgccaccagcaacagcaacaaatgggcgag
gcggaacagaccagcggcaactttctgcgacccattgccttcaagcccattccatttgag
ccggactaccgcatcgcctgccagcagcagcagcagcatcagcagcaactgcagttgcaa
caacagcagcaacagcagcagcagcagcagcagcagcaacagttgcagctgcaacaccaa
cagcagcagcagcatcaacagcaacatcaacatcaacatcaacaacaacatcagtcgctg
cagctgccgacggagggcgggcaggcggggggcgtggcggccgagcggtacggctacgga
tcgacgccgtcacttgccccactgcccaccgcatcggcccagaaatttggcagtaccact
gacctacgacacttggccgctcgacgacgaaatcatcgcctgctgcagcgttgcagtaac
gaggacgccctgacccttgacctcttgagcacgggcagccacgacagacccgatggtgcc
agcagcaagagcagcggcactgtggtgggcagcagcgacttgacgccctcgccgtcggat
tctgggatctcggaactggaggcggcgctgaaggatcgcgattcggagctctcgtacctg
cgacaggccatggagcacaatgagaaagtaattttccaagttcaaaaggacaaggaggtg
tactgggagcacgagacgcagcgtttgcggctcttctacgagggtcagcagcgggagtgt
caactgaagctgcgcaagatggagcagctactcggactgcagcagttccagctgaagcag
cacaagctgcgccaatcggagcaggtcaatcggctgcagcagcagctcgatttggccaga
gactccagccaggggctgcaacagcaggtggacgcactgcgtcaccagctggaggacagc
gagtggcgcgtctgcgagcgcaacggggagatagctttactcaagacgcagctcaaggag
gcgcatctggaaatcaacatgaaggatcatgcgattgtcagcctgaagcacagcagcaac
aggagcagcagcagcagcaacagcaacagcaacaagtcctgtgacacaaacacaagccaa
agtcaaccaaagcagcaggcgaaagaggagcagcagcagcaacagcatccagagttgcag
caacagcaacagcagcagcaacagcaacagcaacagcaacagcaacagcaacagcaacag
caacagcaacagcaacagcaacaacagcagcaacagcagcaacagcaactcaagcaacaa
catcagcccgaccagcagcaactgcagaagatcatcacgctgaaggatcaggtgattgga
gctctgaccagcgagctggccaagttgcgcaaggagctctccgatctggccattgcccac
gagtacggcgaggagccctgcggccgatacactcgtctcaagcagcagctggacaatcta
aacgagatttgccagaagacacgaaagtacacaacaacatccgcatcaccaacagcagta
gcatcgccagcagcacaagtggcaccaccagcaccatcgccggcagcacacgtagcaaca
ccaagctgtgcccaggagctgcccaagttggatgtgctggtgcagcgattgcaattggac
cagggacagggtacgcagcaaacgctggacacgctcatcgaggagtccaccacgtatgcg
gaggatatagccaagctgcgccagaaactggacgactttcgtctgaatctcgagctggag
aagcgtcagtggagcgccgagaaggacaaagtgctgggctaccagaagcagttgcaggcc
cactatattcaaatgtaccagaagctgcgctgcctggatagcgctggagcagcagttggc
caagtggaggccaccagtggtaactga

DBGET integrated database retrieval system