KEGG   Drosophila melanogaster (fruit fly): Dmel_CG16785
Entry
Dmel_CG16785      CDS       T00030                                 
Symbol
fz3
Name
(RefSeq) frizzled 3, isoform C
  KO
K04690  frizzled
Organism
dme  Drosophila melanogaster (fruit fly)
Pathway
dme04150  mTOR signaling pathway
dme04310  Wnt signaling pathway
Brite
KEGG Orthology (KO) [BR:dme00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    Dmel_CG16785 (fz3)
   04150 mTOR signaling pathway
    Dmel_CG16785 (fz3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:dme04030]
    Dmel_CG16785 (fz3)
G protein-coupled receptors [BR:dme04030]
 Frizzled / Smoothened family
  Dmel_CG16785 (fz3)
SSDB
Motif
Pfam: Frizzled Fz Gaa1
Other DBs
NCBI-GeneID: 31023
NCBI-ProteinID: NP_001284760
FlyBase: FBgn0027343
UniProt: O77438 X2JC46
LinkDB
Position
X:769945..784222
AA seq 581 aa
MYAASILILHLTWAVATIAANGAGHNGPVASGAGPNGLQCQPIAVSACQGLGYNMTALPN
LAGHTNQLEAELQIAKLVPLIESGCSRRARFLLCSSLFPLCTPDVPRPVAACKLLCETVR
GECMENAPPELMELWPSFLNCDGLPQPEKHELCMQIPQEVAVPGGSPSGPPTTGSPGVED
HPQTYRFWKSGASPTSDLAGVLCPQNFSGSPFNPEECVPQCQRDAFHTSSQKKTSETLIL
GLSAVCFVLTLFALVTFWAEPTRFGYPERPVLFLCLCYNLFSVCYLERIVFHNQARMHDV
ELQWRLMRPGCLLTPPCLASYITTSYLSLCAASWWLIFALCFYLSSHKKWSSEALEKRSG
LFHVLAWVPPLAPPIAALLLEKVRPSELTGMCYAPGFVELPALVLLLLGLYFTLRASRSL
LSLQQQLQPTLAHHRFGQIRKRFVLFSLLYFAPTTAGVVAALCERYADSVPSCSTPDDCL
SPTPLSAWPALVRIFFQLVGGTLTGLWVWSRKTCESYRNRLGASGTPTSSLMNQSKAAGA
LPKKHLYTSGKSMLPTGGITPLYAGISFHNVPVYNPNQSRV
NT seq 1746 nt   +upstreamnt  +downstreamnt
atgtatgccgcctcgatcctgatcctgcacctgacttgggccgtggccacgatcgcggcc
aacggtgccggccataatggcccggtggcatccggagcagggcctaacggattgcagtgc
cagcccatcgccgtgtccgcctgccaaggcctcggctacaacatgaccgcactgcccaac
ctggcaggtcacaccaatcagctggaggctgagctccagattgccaaactggtgccacta
atagaatccggctgctcgcgtcgcgcccgctttttgctctgctcgtctctgtttccgctg
tgcacgccggatgtgccacgccccgttgccgcctgcaaattgctgtgcgagactgttagg
ggcgagtgtatggaaaacgctccgccggaactgatggagctgtggccttcgttccttaac
tgcgacggactgccgcagccggagaagcacgagttgtgcatgcagattccacaggaggtg
gctgtgccaggcgggagtccaagtggtccgcccaccactggttcacctggcgtcgaagat
cacccgcagacgtaccgcttttggaaaagcggagcatctcccacctctgacttggctggc
gtcttgtgcccgcaaaactttagcggcagtccctttaatccggaggagtgcgtgccccag
tgtcagcgggacgccttccacacgagctctcagaagaagacgtctgagaccctcattcta
ggcctctcggccgtctgcttcgtcctgacactgttcgccttggtgaccttctgggcggag
cccaccaggtttggctaccccgagagaccagtgctcttcctgtgcctgtgctacaacctc
ttcagcgtgtgctatctggagcgaatcgtgttccacaatcaagcaaggatgcatgacgtc
gagctgcaatggcggctgatgcgaccgggttgcttgctgacgcccccttgcctggcctcc
tacataaccacctcctatttaagcctgtgtgcagccagctggtggctgatatttgccctg
tgcttctacctgtcctcccacaaaaagtggtccagcgaggcgctggaaaagaggtccggg
ctgttccacgttctggcctgggtgccaccgctggcgccccccattgccgccctgctgctg
gagaaggtgcgtccgagtgagctgactgggatgtgctacgcaccgggatttgtggagctg
ccagcactggtcctgctcctgcttgggctgtacttcaccctgagagcctccaggtctctg
ctctccctgcagcaacagttgcagcccaccctggcccaccaccgattcgggcagatccgg
aagcgctttgtgctcttctccctgctgtacttcgcacccacgaccgccggcgtcgtggcg
gctctttgcgagcggtacgcggattcagtgcccagctgctccacacccgatgactgcctc
tcacccactccgctcagtgcctggccagcgttggtccggatcttcttccagctggtgggc
ggaacgttgacagggttgtgggtgtggtcgcgcaaaacctgcgagagctacagaaatcgg
ctgggtgccagcggcacacccacctcatccctgatgaatcaaagcaaggcggccggggct
ttgcccaaaaagcatttgtatacgagtgggaaatccatgctgcccacggggggaatcact
cctctatatgctggtattagttttcacaatgtgcccgtctacaaccccaaccaatcgaga
gtttag

KEGG   Drosophila melanogaster (fruit fly): Dmel_CG17697
Entry
Dmel_CG17697      CDS       T00030                                 
Symbol
fz
Name
(RefSeq) frizzled, isoform A
  KO
K02432  frizzled 1/7
Organism
dme  Drosophila melanogaster (fruit fly)
Pathway
dme04150  mTOR signaling pathway
dme04310  Wnt signaling pathway
Brite
KEGG Orthology (KO) [BR:dme00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    Dmel_CG17697 (fz)
   04150 mTOR signaling pathway
    Dmel_CG17697 (fz)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:dme04030]
    Dmel_CG17697 (fz)
G protein-coupled receptors [BR:dme04030]
 Frizzled / Smoothened family
  Dmel_CG17697 (fz)
SSDB
Motif
Pfam: Frizzled Fz 7tm_2
Other DBs
NCBI-GeneID: 45307
NCBI-ProteinID: NP_524812
FlyBase: FBgn0001085
UniProt: P18537
LinkDB
Position
3L
AA seq 581 aa
MWRQILFILPTLIQGVQRYDQSPLDASPYYRSGGGLMASSGTELDGLPHHNRCEPITISI
CKNIPYNMTIMPNLIGHTKQEEAGLEVHQFAPLVKIGCSDDLQLFLCSLYVPVCTILERP
IPPCRSLCESARVCEKLMKTYNFNWPENLECSKFPVHGGEDLCVAENTTSSASTAATPTR
SVAKVTTRKHQTGVESPHRNIGFVCPVQLKTPLGMGYELKVGGKDLHDCGAPCHAMFFPE
RERTVLRYWVGSWAAVCVASCLFTVLTFLIDSSRFRYPERAIVFLAVCYLVVGCAYVAGL
GAGDSVSCREPFPPPVKLGRLQMMSTITQGHRQTTSCTVLFMALYFCCMAAFAWWSCLAF
AWFLAAGLKWGHEAIENKSHLFHLVAWAVPALQTISVLALAKVEGDILSGVCFVGQLDTH
SLGAFLILPLCIYLSIGALFLLAGFISLFRIRTVMKTDGKRTDKLERLMLRIGFFSGLFI
LPAVGLLGCLFYEYYNFDEWMIQWHRDICKPFSIPCPAARAPGSPEARPIFQIFMVKYLC
SMLVGVTSSVWLYSSKTMVSWRNFVERLQGKEPRTRAQAYV
NT seq 1746 nt   +upstreamnt  +downstreamnt
atgtggcgtcaaatcctgtttattttacccaccctgatacagggggtccagcgctacgat
cagagccccctcgatgcgagtccgtattatcgcagcggcgggggattaatggccagttct
gggaccgaactagatggactgccacatcacaatcgctgtgaacccatcaccatatcgatc
tgcaagaatataccatataacatgaccattatgccaaatcttattggccataccaagcag
gaggaggcgggtctggaggtccatcagtttgctccgctcgtgaagatcggctgcagtgat
gacctccagttgttcctctgttccctgtacgttccggtctgcacaattttggagcgaccc
attccgccttgtcgatctctgtgcgaatcggcgcgggtatgtgaaaagttaatgaaaacc
tacaactttaactggccggaaaatctggagtgctccaaatttcccgtccatggaggcgag
gatttgtgcgtggcggagaataccacatcatcggcctccacggcggccacgcccacaagg
agtgtggctaaggtcactacccgtaaacaccagacgggcgtagaaagtccgcaccgaaac
attggattcgtgtgccccgtgcaactgaaaacgcctctgggaatgggctacgaactaaaa
gttggcggaaaggatctgcatgactgtggagccccatgtcatgccatgttcttcccggag
agagaaaggactgtgcttcgatactgggttggatcctgggcagcggtctgtgtagccagc
tgcttgtttacggtgctcaccttcttgattgactcgtcgcgttttcgctacccggagagg
gccattgtcttcttggccgtttgctacttggtagttggatgtgcctacgtggcgggactg
ggagcgggcgactctgtgtcgtgccgcgaaccatttccgccgcccgtcaaactcggccgc
ctgcagatgatgtccaccatcacccagggccaccgacaaaccacgtcctgcacggtttta
ttcatggcactctacttctgctgcatggcggccttcgcgtggtggtcgtgtctggcattc
gcctggtttttggccgctggcctcaaatggggccacgaggcgattgagaacaagtcgcac
ttattccacctggttgcctgggcggtgcccgcccttcagaccatctccgttctggccctg
gctaaagttgaaggtgacatcctttctggcgtttgtttcgtgggccagctggacacgcac
tccctgggcgcgttcctgatccttccactctgcatttatctctcgatcggagcactattc
ctgctggccggatttatttcgcttttccggatccggacagttatgaaaacggacggaaag
aggacagacaaactggagcgcctgatgttgcgaataggtttcttctctggacttttcatt
ctgcccgccgtgggattactgggctgcttgttctacgagtactacaactttgacgagtgg
atgatccaatggcacagggatatctgcaagcccttctcaattccgtgcccggcagccagg
gcgccgggatctccagaagcccgccccatctttcagatctttatggtcaagtacctttgc
tccatgctggtgggggtcacttccagcgtttggctgtattccagcaagacgatggtcagc
tggcggaacttcgtggagaggttgcagggcaaggagccccggacccgggcgcaggcgtac
gtctag

KEGG   Drosophila melanogaster (fruit fly): Dmel_CG4626
Entry
Dmel_CG4626       CDS       T00030                                 
Symbol
fz4
Name
(RefSeq) frizzled 4, isoform A
  KO
K02354  frizzled 4
Organism
dme  Drosophila melanogaster (fruit fly)
Pathway
dme04150  mTOR signaling pathway
dme04310  Wnt signaling pathway
Brite
KEGG Orthology (KO) [BR:dme00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    Dmel_CG4626 (fz4)
   04150 mTOR signaling pathway
    Dmel_CG4626 (fz4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:dme04030]
    Dmel_CG4626 (fz4)
   04090 CD molecules [BR:dme04090]
    Dmel_CG4626 (fz4)
G protein-coupled receptors [BR:dme04030]
 Frizzled / Smoothened family
  Dmel_CG4626 (fz4)
CD molecules [BR:dme04090]
 Proteins
  Dmel_CG4626 (fz4)
SSDB
Motif
Pfam: Frizzled Fz
Other DBs
NCBI-GeneID: 31659
NCBI-ProteinID: NP_511068
FlyBase: FBgn0027342
UniProt: Q9NBW1 A4V438
LinkDB
Position
X:complement(7106272..7110321)
AA seq 705 aa
MKPTCILCLLVVILLHPRISKSSTSGNPSASSSSSSPPEIPAFRQCETIRIEMCRKIGYN
ETSMPNLVGNEMQTDVEYTLQTFAPLIEYDCSSQLKLFLCAAYVPMCTPKAPVHAIGPCR
SLCESVRIRCHPVLQGFGFPWPPALDCDKFPRENNHETMCMEGPGELHQPQQEQDLYGLP
GQGIPGGLGGKLPMDCSGLAKSHLYVRLPRSGRCAPLCEADILFTPAEKHLAEIWVSTWA
YAALGLALVATVCLLASDGSRLASAKWSRLLSPLIWCHNMVTLGWAVRFMVGRTGTACGT
DPQAPNESLLTVDGLSNASCASVFLMRYYFGMAACAWWAVLCLGWHRDIRRHSPDSKGHV
VIPSNFGGSPAKRNSAKTAQQDLTQNNFVCFVAWGLPAFQTSAVIVARFVDADELLGACF
VGNQSDKALQILVATPVFCYWIFGSMNLISGYLVHCRTKEILRNSNALSVQQQLQQLSAH
SSSGIGIFLFIYGLACAMLLLAVIYEFANIDVWLGSGDTNTPLWPFLLRAFMELMLGICC
FAWVLGPSISTLYKRQVSNGKMVKHTSAGAATGHLDGHSSSRGSHAACNSTVVSYHSVRT
SMASVPLPPSPYKLKTSPGTGSISLNQMSNYSLGRSVHHQQRHSPHHHHHQQQQHHQFHP
HHNHQHHSTSSHRLYYPPGSYASQKYSQHGSYYPHLQQYGNETLL
NT seq 2118 nt   +upstreamnt  +downstreamnt
atgaagccaacctgcatattgtgtctcctggtggtgatcctcctgcatccgcgcatctca
aaatcctcaacgagcggcaaccccagtgccagttccagttccagttctccgccagaaatc
cccgccttccggcaatgcgaaaccattcgcattgagatgtgccgcaagatcggctacaat
gagacctccatgccaaatctggtgggtaacgaaatgcaaacggacgtggagtacacactg
caaacctttgcaccactgatcgaatacgactgcagttcccagttgaagctgttcctgtgc
gccgcctacgtgcccatgtgcacgcccaaagctccagtccatgccatcggtccgtgccgg
agtctctgtgagtccgtgcgaatacgttgtcatccagttttgcagggattcggatttcca
tggccaccggctctcgactgcgataaatttccgcgagagaacaaccacgagacgatgtgt
atggaaggtcccggtgaattgcatcagccgcagcaggagcaggatttgtatgggctaccg
ggccaaggaatacccggtggattgggcggtaaactgcccatggattgctcgggactggcc
aaatcgcatctgtacgtaaggctacccagatctggacgctgtgcaccactctgcgaggcg
gacatactgttcacaccggcggagaagcatctggcagagatctgggtctccacatgggcc
tatgccgctttgggtttggccctggtagccaccgtgtgtcttttggccagcgatggcagt
cgtttggccagcgccaagtggtccagattgttgtcgccgctgatttggtgccacaacatg
gtcaccttgggctgggcagtgcgctttatggtgggaagaacgggaactgcgtgcggcacg
gatccccaggcgcccaatgaatccctactcaccgtggacggactgtccaatgcctcctgc
gctagtgtcttccttatgcgctactattttggaatggccgcctgcgcttggtgggctgtg
ctctgtttgggctggcaccgcgacattcgtcggcacagtccggactccaagggccatgtg
gtcattccctcgaactttggaggcagtccggcgaagaggaacagtgccaagacggctcag
caggatctaacgcaaaacaactttgtgtgcttcgtggcctggggattgccggcctttcaa
acgtcagcagtgatcgttgcccgtttcgtggatgctgacgagttgcttggcgcctgtttc
gtaggcaatcagtcggataaggcgctacagatattggtggctacgcccgttttttgctac
tggatctttggctcgatgaatctgatctccggctatttggtacactgtcgcaccaaggag
atcctgaggaatagcaatgcactcagcgtgcaacagcaactgcaacagctaagcgcacac
agtagttccggcattggcatattccttttcatctatggacttgcatgtgccatgcttctg
ttggctgtcatttacgagtttgccaacatcgatgtctggctgggatcgggtgataccaat
acgccactttggccatttttgttgcgcgccttcatggaactgatgctgggcatttgctgt
tttgcctgggtacttggaccaagcatttccactctctacaagaggcaagtcagcaatggc
aaaatggtgaagcatacgtctgccggagcagcaactggacacctggacgggcatagtagc
tcgcgtggatcgcatgcggcttgcaatagcacggtggtctcctaccattcggtgcgaact
tctatggccagtgttccgttgccgccaagtccgtacaaactgaagacttcgcctggtacc
ggctctatatcgctgaatcagatgtccaactattcgctgggcaggagcgtgcatcaccag
cagcgccattcgccgcatcatcatcatcaccagcagcagcagcatcatcagttccatccc
caccacaatcaccagcatcactccacatcctcgcatcggctgtattatccgccaggtagc
tatgcctcgcaaaagtacagccagcacggcagctactatccccacttgcagcagtatggc
aatgagacgctactctag

KEGG   Drosophila melanogaster (fruit fly): Dmel_CG9739
Entry
Dmel_CG9739       CDS       T00030                                 
Symbol
fz2
Name
(RefSeq) frizzled 2, isoform C
  KO
K02375  frizzled 5/8
Organism
dme  Drosophila melanogaster (fruit fly)
Pathway
dme04150  mTOR signaling pathway
dme04310  Wnt signaling pathway
Brite
KEGG Orthology (KO) [BR:dme00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    Dmel_CG9739 (fz2)
   04150 mTOR signaling pathway
    Dmel_CG9739 (fz2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:dme04030]
    Dmel_CG9739 (fz2)
G protein-coupled receptors [BR:dme04030]
 Frizzled / Smoothened family
  Dmel_CG9739 (fz2)
SSDB
Motif
Pfam: Frizzled Fz
Other DBs
NCBI-GeneID: 40090
NCBI-ProteinID: NP_001097643
FlyBase: FBgn0016797
UniProt: Q9VVX3 B7Z072
LinkDB
Position
3L
AA seq 694 aa
MRHNRLKVLILGLVLLLTSCRADGPLHSADHGMGGMGMGGHGLDASPAPGYGVPVIPKDP
NLRCEEITIPMCRGIGYNMTSFPNEMNHETQDEAGLEVHQFWPLVEIKCSPDLKFFLCSM
YTPICLEDYHKPLPVCRSVCERARSGCAPIMQQYSFEWPERMACEHLPLHGDPDNLCMEQ
PSYTEAGSGGSSGGSGGSGSGSGSGGKRKQGGSGSGGSGAGGSSGSTSTKPCRGRNSKNC
QNPQGEKASGKECSCSCRSPLIFLGKEQLLQQQSQMPMMHHPHHWYMNLTVQRIAGVPNC
GIPCKGPFFSNDEKDFAGLWIALWSGLCFCSTLMTLTTFIIDTERFKYPERPIVFLSACY
FMVAVGYLSRNFLQNEEIACDGLLLRESSTGPHSCTLVFLLTYFFGMASSIWWVILSFTW
FLAAGLKWGNEAITKHSQYFHLAAWLIPTVQSVAVLLLSAVDGDPILGICYVGNLNPDHL
KTFVLAPLFVYLVIGTTFLMAGFVSLFRIRSVIKQQGGVGAGVKADKLEKLMIRIGIFSV
LYTVPATIVIGCYLYEAAYFEDWIKALACPCAQVKGPGKKPLYSVLMLKYFMALAVGITS
GVWIWSGKTLESWRRFWRRLLGAPDRTGANQALIKQRPPIPHPYAGSGMGMPVGSAAGSL
LATPYTQAGGASVASTSHHHLHHHVLKQPAASHV
NT seq 2085 nt   +upstreamnt  +downstreamnt
atgagacacaatcgactgaaggtcctgatcctgggactcgtcctcctgctgacatcttgt
cgagcggatggaccgctgcacagtgcggatcacggcatgggcggaatgggcatgggtggt
cacggcctggacgcgagtcccgcacccggttacggagtgccagtcatacccaaggatccc
aatctgcgatgcgaggagatcaccataccaatgtgtcggggcattggctacaacatgaca
tccttccccaacgaaatgaaccatgagacccaggacgaagcgggcctggaggtgcaccag
ttctggcccctggtggagatcaaatgctcgccggacctcaagttcttcctgtgcagcatg
tacacgcccatctgcctggaggattaccacaagccgctgcccgtttgccggagtgtctgc
gagagagcccgctcgggatgcgcacccatcatgcagcagtacagcttcgaatggccggag
agaatggcgtgcgagcacttgcctcttcatggtgaccccgacaatctgtgcatggaacag
ccctcgtacacggaggctggcagcggtggcagctcgggcggatcgggtggctctggcagc
ggttccggctccggcggcaaacggaagcaaggaggcagtggctcgggcggcagtggggcc
ggcggcagcagcggttccacctcaacgaagccgtgccgcggacgcaattcaaaaaactgc
caaaatccccaaggagaaaaggcaagcggaaaagagtgcagctgctcgtgccgctcccca
ctcatcttcctggggaaggagcagctgctgcagcagcagtcgcagatgcccatgatgcac
catccacaccactggtacatgaacctcactgtccaaaggatcgccggcgttccaaactgc
ggcataccgtgcaaggggcccttcttcagcaacgacgaaaaggatttcgccggcctctgg
atcgccctgtggtcgggactgtgcttctgcagcacgctcatgaccctaaccacattcatc
atcgacaccgaaaggtttaagtacccggagcggcccattgtcttcctctccgcctgctac
ttcatggtggcagtgggctacctgtcgcgcaacttcctgcagaacgaggagatcgcctgc
gacggcctgctgctccgggaaagctccacgggtccgcactcgtgcaccctggtcttcctg
cttacctacttctttggcatggcctcgtccatctggtgggtgatcctcagtttcacctgg
ttcctggccgctggtctgaagtggggcaatgaggccatcaccaagcactcgcagtacttc
cacctggccgcctggttgattcccactgtccagtccgtggccgtactcctgctctcggcg
gtggatggcgatcccattctgggcatctgctatgtgggcaacctcaatccggatcaccta
aagacctttgtgctggccccgctcttcgtttacctcgtaatcggcaccaccttcctgatg
gccggctttgtgtccctcttccgcatccgctcggttatcaagcaacagggcggtgtagga
gctggtgtcaaggcggacaagctggagaaactgatgatcaggattggcatcttctcggtg
ctctacacggtgccggccaccatagttatcggatgttacctgtacgaagcagcctacttt
gaggactggatcaaggccctggcctgtccatgcgcccaggtgaagggtcccggcaagaag
cctctctactcggtcctgatgctcaagtacttcatggccctggccgtgggcatcacctcg
ggcgtgtggatctggtctggcaagacgctggagagctggcgacgcttctggcggagactc
ctaggagcgccggaccgcacgggcgccaaccaggcgctgatcaagcagcggcctccgatc
ccgcatccctatgccggatctggaatgggaatgcccgtgggctcggcggcgggctccctg
ctggccacgccctacacccaggcgggcggagcctcggtggcctccaccagccaccaccac
ctgcaccaccacgttctcaagcagccggcggccagccacgtatga

DBGET integrated database retrieval system