Drosophila melanogaster (fruit fly): Dmel_CG16837 Help Entry Dmel_CG16837      CDS       T00030                                  Symbol CG16837 Name (RefSeq) uncharacterized protein   KO K10419   dynein light chain roadblock-type Organism dme  Drosophila melanogaster (fruit fly) Pathway dme04145   Phagocytosis dme04814   Motor proteins Brite KEGG Orthology (KO) [BR:dme00001]  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagocytosis     Dmel_CG16837 (CG16837)   09142 Cell motility    04814 Motor proteins     Dmel_CG16837 (CG16837)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:dme04131]     Dmel_CG16837 (CG16837)   09183 Protein families: signaling and cellular processes    03037 Cilium and associated proteins [BR:dme03037]     Dmel_CG16837 (CG16837)    04812 Cytoskeleton proteins [BR:dme04812]     Dmel_CG16837 (CG16837) Membrane trafficking [BR:dme04131]  Endosome - Golgi transport   Rab GTPases and associated proteins    Rab associated proteins     Dmel_CG16837 (CG16837) Cilium and associated proteins [BR:dme03037]  Motile cilia and associated proteins   Dynein arm    Dmel_CG16837 (CG16837) Cytoskeleton proteins [BR:dme04812]  Eukaryotic cytoskeleton proteins   Microtubules    Tubulin-binding proteins     Dyneins      Dmel_CG16837 (CG16837) SSDB OrthologParalogGFIT Motif Pfam:  Robl_LC7 Motif Other DBs NCBI-GeneID:  37904 NCBI-ProteinID:  NP_611916 FlyBase:  FBgn0035009 UniProt:  D3DMQ2 Q9W168 LinkDB All DBs Position 2R Genome browser AA seq 130 aa AA seqDB search MSRSSRLSVTETQRKSTPVVKKAVIRSRSYDGDAFVNLFAHRGARDIMILDSHGVPLRST CSQRRTFVFVSNLKPLLFMARNVVRDLDPSNDITFMRIRSNMGEIHMTLGTDFILIVVQK LRRLRSSSTS NT seq 393 nt NT seq  +upstreamnt  +downstreamnt atgtccagaagttcgaggttatcagtaactgaaactcagcgcaaaagcactccagtggta aagaaggcggttattcgcagtcgatcctacgatggggatgcgttcgtcaatctcttcgcc catcgcggcgcccgagacatcatgatcttggatagccatggagtgcccctccgatccacc tgcagtcagagacgcaccttcgtgttcgtctctaacctgaagccgctgctcttcatggcc cgcaacgtggtcagggatctggacccctcgaacgacataaccttcatgcggattcgctcc aatatgggcgaaatccacatgaccctgggcacggacttcattttgatcgttgtgcagaag ctgaggaggctcaggagcagctcaacatcataa

DBGET integrated database retrieval system