Drosophila melanogaster (fruit fly): Dmel_CG16844 Help Entry Dmel_CG16844      CDS       T00030                                  Symbol BomS3 Name (RefSeq) bomanin short 3, isoform B   KO K20695   immune-induced peptide 1/2/3 Organism dme  Drosophila melanogaster (fruit fly) Pathway dme04624   Toll and Imd signaling pathway Brite KEGG Orthology (KO) [BR:dme00001]  09150 Organismal Systems   09151 Immune system    04624 Toll and Imd signaling pathway     Dmel_CG16844 (BomS3) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  DIM Motif Other DBs NCBI-GeneID:  50209 NCBI-ProteinID:  NP_001286569 FlyBase:  FBgn0040736 UniProt:  Q9V8G0 A0A0B4LGW9 LinkDB All DBs Position 2R Genome browser AA seq 39 aa AA seqDB search MKFLSLAFVLGLLALANATPLNPGNVIINGDCRVCNVRA NT seq 120 nt NT seq  +upstreamnt  +downstreamnt atgaaattcctatcactcgccttcgttttgggtctgctggctctggccaacgccactccc ctgaatcctggcaatgtcatcatcaatggcgattgccgcgtctgcaatgtgagggcctaa

DBGET integrated database retrieval system