KEGG   Drosophila melanogaster (fruit fly): Dmel_CG17610
Entry
Dmel_CG17610      CDS       T00030                                 

Gene name
grk
Definition
(RefSeq) gurken
  KO
K02447  protein gruken
Organism
dme  Drosophila melanogaster (fruit fly)
Pathway
dme04013  MAPK signaling pathway - fly
dme04320  Dorso-ventral axis formation
Brite
KEGG Orthology (KO) [BR:dme00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04013 MAPK signaling pathway - fly
    Dmel_CG17610 (grk)
 09150 Organismal Systems
  09158 Development and regeneration
   04320 Dorso-ventral axis formation
    Dmel_CG17610 (grk)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:dme03019]
    Dmel_CG17610 (grk)
Messenger RNA biogenesis [BR:dme03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Factors involved in mRNA localization
    Factors that have mRNA localization signals
     Dmel_CG17610 (grk)
SSDB
Motif
Pfam: EGF Apolipoprotein
Other DBs
NCBI-GeneID: 34171
NCBI-ProteinID: NP_476568
FlyBase: FBgn0001137
UniProt: P42287
LinkDB
Position
2L
AA seq 295 aa
MMQIPFTRIFKVIFVLSTIVAVTDCCSSRILLLREHTLKIVQHQHSHMHEHAHELQQQIQ
ETAVELLNRLELQRKQLEASAQEEADQLHPDTDPNPDSGGQLPNADDSIAADPEQDGIIL
GSSTDTWLASESSTPITDSETVTTPETVTHTGEPPPDPSSSSTPDSTTPSPNDKETEIQM
LPCSEAYNTSFCLNGGHCFQHPMVNNTVFHSCLCVNDYDGERCAYKSWNGDYIYSPPTAQ
RKVRMAHIVFSFPVLLMLSSLYVLFAAVFMLRNVPDYRRKQQQLHLHKQRFFVRC
NT seq 888 nt   +upstreamnt  +downstreamnt
atgatgcaaatcccatttactcggattttcaaagtaattttcgtgctctcaacaattgtc
gccgtcacagattgttgttcgagccgaatcttacttctccgagagcatacgctgaaaatt
gtgcagcatcagcacagccacatgcacgagcatgcgcacgagctgcagcagcagatccag
gagaccgcggttgagttgctcaatcgcctggagctgcagcgcaagcaactggaggcctcg
gcccaggaggaggcagaccagctgcatcccgatacggatcccaatccggactcgggcggc
caactgccaaacgcagacgactccattgctgcggatccggaacaggatgggataattctc
ggatccagtaccgacacctggttggccagcgaaagcagcacaccaatcactgattccgag
acagtgacaacacccgaaactgttacccacaccggagaaccgccacctgaccccagttcg
tccagcacgcctgactccacgactcccagcccgaacgacaaggagacagagattcagatg
ctgccctgcagcgaagcttacaatactagcttttgcctgaacggcggccactgcttccag
catccgatggtgaacaacacagtcttccattcctgcctctgcgttaacgactacgatgga
gagcggtgcgcctacaagagctggaatggtgactacatctattcgcctccaacagcgcag
cggaaggtccgaatggcgcacatcgtcttctcctttcccgtactcctcatgctgtcgtcg
ctctacgttctcttcgcagccgttttcatgctccgcaatgtgccggattatcgccggaag
cagcagcaactacacctgcataagcagcgcttttttgtcagatgctga

DBGET integrated database retrieval system