KEGG   Drosophila melanogaster (fruit fly): Dmel_CG17664
Entry
Dmel_CG17664      CDS       T00030                                 
Symbol
Eglp2
Name
(RefSeq) entomoglyceroporin 2, isoform A
  KO
K09884  aquaporin rerated protein, invertebrate
Organism
dme  Drosophila melanogaster (fruit fly)
Brite
KEGG Orthology (KO) [BR:dme00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:dme02000]
    Dmel_CG17664 (Eglp2)
Transporters [BR:dme02000]
 Other transporters
  Aquaporins and small neutral solute transporters [TC:1.A.8]
   Aquaporins
    Dmel_CG17664 (Eglp2)
SSDB
Motif
Pfam: MIP
Other DBs
NCBI-GeneID: 37737
NCBI-ProteinID: NP_611811
FlyBase: FBgn0034883
UniProt: Q9W1M3
LinkDB
Position
2R
AA seq 265 aa
MATTASQSNCWLLQRRQLDSITTVLAEMIATAMLMFLGCMGSVENSVFTNSDFQSALNFG
FVVLICIQCFGCVCGAHLNPAVTLATYVYNMISLPMALAYFVAQMVGAFIGYGLLKAVLP
ESAIYSAENPNGVCLTSLNSTLTPWQGLAVEFLITCVLISVCCGVWDPRNATKQDSLPVR
FGLAIACLSLTAGQLTGASMNPVRSFAPAIWNGFWDDHWIYWVGPMAAALITSVIYKHAF
RRELEESEVDETTMSTKRTSEAELA
NT seq 798 nt   +upstreamnt  +downstreamnt
atggctacaaccgcaagccaatccaactgctggctgctgcagcgccgccagctggacagc
atcacaacagttcttgccgagatgatagccaccgctatgctgatgttcctcggatgcatg
ggcagtgtggagaactccgtgttcaccaactcggacttccagagcgccctgaacttcgga
ttcgtggtgctaatctgcatccagtgcttcggttgcgtgtgtggcgcccacctgaatccc
gccgtcaccctggccacctacgtctacaacatgatctccctgccgatggctttggcctat
tttgtggcccagatggtgggcgccttcattggctacggcctgctgaaggcggtgctcccg
gagagcgccatctacagcgctgagaaccccaatggcgtctgcctcacctcgctcaacagc
accttgaccccatggcagggactggccgtggagttcctgatcacctgcgtcctcatctcc
gtgtgctgcggcgtctgggatccccgcaatgccaccaagcaggactcgctgccagtgcga
tttggtctggccatcgcatgcctgtcgctcacagcgggacaactgactggggctagtatg
aatccagtccgatcctttgctccggccatttggaacggattctgggatgaccactggatc
tactgggtgggtcccatggcggctgccctgatcacctcggtgatctacaagcacgccttc
cggcgggagctggaggaatcggaggtggacgagacgacgatgtcaaccaagaggacctcg
gaggcggagctcgcctaa

DBGET integrated database retrieval system