KEGG   Drosophila melanogaster (fruit fly): Dmel_CG2019
Entry
Dmel_CG2019       CDS       T00030                                 

Gene name
disp
Definition
(RefSeq) dispatched
  KO
K24680  protein dispatched 1
Organism
dme  Drosophila melanogaster (fruit fly)
Pathway
dme04341  Hedgehog signaling pathway - fly
Brite
KEGG Orthology (KO) [BR:dme00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04341 Hedgehog signaling pathway - fly
    Dmel_CG2019 (disp)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:dme04990]
    Dmel_CG2019 (disp)
Domain-containing proteins not elsewhere classified [BR:dme04990]
 Other domain-containing proteins
  Patched domain-containing proteins
   Dmel_CG2019 (disp)
SSDB
Motif
Pfam: Patched Sterol-sensing
Other DBs
NCBI-GeneID: 44274
NCBI-ProteinID: NP_524734
FlyBase: FBgn0029088
UniProt: Q9VNJ5
LinkDB
Position
3R
AA seq 1218 aa
MLCFDSERMNWYYHVLARRPYLVVVSIAVYCVACIIVALVLNKLPDFSDPTLGFETRGTK
IGERLTAWYNLLQETDHHGALFSNPSDLWERRRVEQGYVETKLHPNHRRRKNKHKNRNKN
KRRKEQNQSSHEHHDVAQKMMQFKKRLKATSSPSPNLGFDTWIGDSGVFRDYEITNDSAS
SSLEPTRRTEQIEYGHNTTSVDEEEHQQRVQTKKSTWRLLKQAATLPTDGWADMHRRQPI
EGFFCDSSPRKEYSHFVVQRIGPNATDSLFDLNGLLAMCQLQDQITEVPSYRAFCEPEML
TTECCRPWSLPNYAAMLANKSSCFDLTTEDVTSLHTLLLGCYEYFHDLKMDNHCNEIPHC
RAPEECKRLNIVFNVLNFLTDFSFIKSNDSNVYLKYAMIFIPVAQSNRLLPLFHEWEDVE
LINELVEVVAMDLGLENELFNELLLTDVWLVSLGGTFVMASVWLYTGSAFITLMSCVAIC
FSLGLAYFFYAIVLEFEFFPYMNLLAVVVIIGIGADDVFLFLKIWHCVLTERFSNRCTLT
TQSQSALPTLENSDHTESLENIMALTMRHAAASMFVTSLTTAGAFYASYSSSITAIKCFG
IFAGTVVVTNYLLMITWLPASVSIMERLFATRMSCHHPMSIKLIHACKKSINRFCQMFEE
CITKSIMNYAYLWLLIFGALGASSAVIVFWYPGLQLPEKSHFQLFVSKHPFEVYSSLKQQ
FWFEKPLQAYENFKMHMHFVWGVQAVDDGDYTNPNSYGHLHYDNNFNVSSRPAQLWILDF
CQSVRQQPFYKETLGMLLPNCFIENLIDYMKRRCIDDMDSTRKDRSPCCDAQFPFEPHIF
EYCLPQSISNMYDTTFFRPGVAGPKFAEAPRLETEDYLGMSGNESAEYSTNGSFTPLLVK
ALVIEFESNVAYSTIYANIRQFYESVEHWFQMQLKTAPPELQGGWFTSDLKFYNVQDTLS
HDTFVAICLAMAASLAVLLCFTVNILISIYAVLTVSLSIFNTVAVLILLGWQLNILESIA
VSTAIGLAVDFSLHYGIHYRMSPVKERLAATQFVLSRIIGPTVMAATTTGLAGGIMMASN
ILPYIQIGVFLVVVMIVSWFYATFFLMSLLRVAGPQHGFLELKWPLWSKRSSGSSKFYER
KPSQVIASEQLLTPTSSAIVELANSETHELESLNSNSLIKTISGIESAHALSSLPRDFEH
SFQTMHECKYQTYPSTSN
NT seq 3657 nt   +upstreamnt  +downstreamnt
atgttgtgcttcgactcggagaggatgaactggtactaccacgtcctggccaggcgtccc
tacctggtggtcgtctccattgctgtctactgtgtcgcttgcatcatcgtggccctcgtc
ctgaacaagctgccggacttcagtgatcccaccttgggcttcgaaacccgcggcaccaaa
attggagaacgactgacggcctggtacaacctgctgcaagagactgaccaccatggtgct
cttttctcaaatccatcggatctgtgggagaggagacgggtagagcagggctatgtggag
acgaagctgcatccgaatcacaggcgacgcaaaaacaagcacaagaacagaaacaagaac
aagcgacgcaaggaacaaaatcaaagcagccacgagcatcacgatgtggcgcagaagatg
atgcagttcaaaaaacggctgaaggctactagttctccctctccaaatctcggctttgac
acctggatcggggacagtggagtatttcgcgactacgagattacaaacgacagcgcttcc
tcctctttggaacccacgcgacgcactgagcaaatcgaatatggccacaacaccacctca
gtggacgaggaagagcatcagcagcgggtgcagaccaagaagagcacttggcggctccta
aagcaagccgccaccttgcccaccgacggttgggcagacatgcatcgtcgccaacccatc
gagggattcttttgcgattcatcgccccggaaggagtactctcattttgtggtccagcgg
atcggtcccaacgccaccgattctctatttgatttgaacggactgctggccatgtgtcag
ttgcaggatcagattaccgaagtccccagctaccgggcattttgcgagccggagatgctt
accaccgagtgctgccggccatggtcactgcccaactacgccgccatgctggccaacaaa
agttcctgtttcgaccttaccacggaggatgttacttcgctgcacacgctgctcttgggc
tgctatgagtacttccatgacctaaagatggacaaccactgcaacgaaataccgcattgt
cgtgctcctgaagagtgcaagcggctaaatatcgtctttaacgtcctgaattttctcacc
gactttagtttcatcaagtctaatgactcgaatgtatacctgaaatacgccatgattttt
atacccgtggcgcaatccaaccgcttgctgccactgttccacgaatgggaagacgtggag
ctgatcaacgagcttgtggaagtggttgcgatggacttgggcctcgaaaacgaactcttt
aacgagctgctgctgacggacgtgtggctagtttcgctgggagggacattcgtcatggct
agcgtgtggttgtacacgggatcggcattcatcaccttgatgtcctgcgtagccatatgc
ttttcgctaggactagcgtactttttttacgccatcgtgctggagtttgagttcttcccc
tatatgaaccttctggccgtggtagtaataattggcattggagcagacgacgtatttctg
tttcttaagatctggcactgtgtgctgaccgagaggttcagcaatcgatgtaccttgacc
actcagtcccagagtgctcttcccaccctggagaacagtgatcacacggagtcactggaa
aacataatggcgctgactatgcgacatgccgctgcctccatgttcgttacctcacttacc
accgccggcgccttttatgcctcctacagcagctctataacagctataaagtgctttggg
atttttgcgggaactgtcgtggtgaccaactacttactaatgataacttggttgcctgca
tcggtctccatcatggaacgactatttgccacaaggatgtcctgccatcatccgatgtca
ataaagctgatccacgcctgcaagaagtcaattaaccgattttgtcagatgtttgaggag
tgcatcacgaaaagcatcatgaactatgcctatctctggctgctgatctttggggctcta
ggcgcgtccagtgccgtcattgtgttctggtatccaggacttcagttgccggaaaaatca
cacttccagctctttgtgtcaaagcatccatttgaggtttactccagtctcaagcagcag
ttctggttcgagaaaccattgcaggcgtacgagaacttcaagatgcacatgcatttcgtc
tggggcgttcaagcggtggacgacggcgactatacgaaccccaactcatacggccacctg
cactatgacaataattttaacgtatccagcaggccggcacaactctggatccttgatttt
tgccagagtgtgcgccagcaacccttttacaaagagactctcggcatgctgttgcccaat
tgtttcattgaaaatcttatcgactatatgaagcgcagatgcatcgatgatatggacagt
accaggaaagaccgttcaccctgctgtgacgcacagtttccctttgagccgcacatattt
gagtactgcttgccacaaagcatatccaacatgtatgacactacatttttccggcccggc
gtggcaggacccaagtttgcagaggctccccgactggagactgaggattacctaggaatg
agtggaaatgagagtgcagagtacagcaccaacggatcatttacaccgctactagtcaaa
gccctggtcatcgagttcgagtccaacgtggcctacagcaccatctacgcaaatattagg
cagttctacgagtctgtagagcactggtttcagatgcagttaaaaacggcaccgccggaa
cttcaaggaggatggttcacgagcgacctgaaattttacaatgtgcaggacaccctttcg
cacgacacctttgttgccatttgtctggccatggctgcatcacttgcagtgctcctatgc
ttcaccgtaaacatattgatttccatctacgccgtactaaccgtgtcgctaagtattttt
aacaccgtggctgtgctcatcctgctcggctggcagcttaacatcttggagagcattgcg
gtgagcacggctatcggtctggctgtggactttagcctacattacggtattcactaccgg
atgtccccggttaaggagagattggcagccacacagtttgtactatcccgcatcattgga
cccacagtgatggcggccaccacaactggtctagctggcggaatcatgatggcatccaac
atattgccctacatacagattggcgtcttcctggtcgttgtcatgatcgttagctggttc
tatgccactttctttctaatgagtctgcttcgggttgccggtcctcagcatggttttctg
gaactcaagtggccgttgtggagcaagcgaagcagtggcagcagcaagttctacgagcgg
aaacccagccaagtgatcgccagcgagcagctgctgacccccacaagctcggccatcgtt
gagttggcgaactcggagacgcacgaactggagtccctaaactccaacagcctgatcaaa
accatttcgggcatcgaaagcgcccacgcattgtcctcgctgccgagggacttcgagcac
tcattccagacgatgcacgagtgcaaatatcaaacgtatccgtctacatccaattga

DBGET integrated database retrieval system