KEGG   Drosophila melanogaster (fruit fly): Dmel_CG2048
Entry
Dmel_CG2048       CDS       T00030                                 
Symbol
dco
Name
(RefSeq) discs overgrown, isoform D
  KO
K08960  casein kinase 1, epsilon [EC:2.7.11.1]
Organism
dme  Drosophila melanogaster (fruit fly)
Pathway
dme04068  FoxO signaling pathway
dme04310  Wnt signaling pathway
dme04341  Hedgehog signaling pathway - fly
dme04391  Hippo signaling pathway - fly
dme04392  Hippo signaling pathway - multiple species
dme04711  Circadian rhythm - fly
Brite
KEGG Orthology (KO) [BR:dme00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    Dmel_CG2048 (dco)
   04341 Hedgehog signaling pathway - fly
    Dmel_CG2048 (dco)
   04391 Hippo signaling pathway - fly
    Dmel_CG2048 (dco)
   04392 Hippo signaling pathway - multiple species
    Dmel_CG2048 (dco)
   04068 FoxO signaling pathway
    Dmel_CG2048 (dco)
 09150 Organismal Systems
  09159 Environmental adaptation
   04711 Circadian rhythm - fly
    Dmel_CG2048 (dco)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:dme01001]
    Dmel_CG2048 (dco)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:dme03036]
    Dmel_CG2048 (dco)
Enzymes [BR:dme01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     Dmel_CG2048 (dco)
Protein kinases [BR:dme01001]
 Serine/threonine kinases: CK1 group
  CK1 family [OT]
   Dmel_CG2048 (dco)
Chromosome and associated proteins [BR:dme03036]
 Eukaryotic type
  Centrosome formation proteins
   Kinases and associated factors
    Dmel_CG2048 (dco)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Pkinase_fungal APH TrbL_3
Other DBs
NCBI-GeneID: 43673
NCBI-ProteinID: NP_001263132
FlyBase: FBgn0002413
UniProt: O76324 A0A0B4KHX3
LinkDB
Position
3R
AA seq 440 aa
MELRVGNKYRLGRKIGSGSFGDIYLGTTINTGEEVAIKLECIRTKHPQLHIESKFYKTMQ
GGIGIPRIIWCGSEGDYNVMVMELLGPSLEDLFNFCSRRFSLKTVLLLADQMISRIDYIH
SRDFIHRDIKPDNFLMGLGKKGNLVYIIDFGLAKKFRDARSLKHIPYRENKNLTGTARYA
SINTHLGIEQSRRDDLESLGYVLMYFNLGALPWQGLKAANKRQKYERISEKKLSTSIVVL
CKGFPSEFVNYLNFCRQMHFDQRPDYCHLRKLFRNLFHRLGFTYDYVFDWNLLKFGGPRN
PQAIQQAQDGADGQAGHDAVAAAAAVAAAAAASSHQQQQHKVNAALGGGGGSAAQQQLQG
GQTLAMLGGNGGGNGSQLIGGNGLNMDDSMAATNSSRPPYDTPERRPSIRMRQGGGGGGG
GVGVGGMPSGGGGGGVGNAK
NT seq 1323 nt   +upstreamnt  +downstreamnt
atggagctgcgcgtgggtaacaaatatcgcctgggccgcaagataggatcgggatcgttc
ggcgacatctacctgggcaccacgatcaacactggcgaggaggtggccatcaagctggag
tgcatccgcaccaaacacccccagctgcacatcgagtcaaagttctacaagacgatgcag
ggtggcataggcataccccgcataatctggtgcggcagcgagggcgactacaatgtgatg
gtgatggagctactcggaccctcgctggaggacctcttcaacttttgttcacgccgcttt
tcgttgaagacggttctgctgctggcggaccagatgatctcccgcatcgattacatacac
tcgcgggacttcatccatcgcgacatcaagccggataacttcctcatgggtcttggcaaa
aagggcaacctggtgtacatcattgactttggcctggccaagaaattccgcgatgcccgg
tcgctgaagcacattccctatcgggaaaacaagaacctcacgggcactgcccgctatgcc
tccatcaacacacatttgggcattgagcaatcgcgtcgtgacgacctggagtccctgggc
tacgtcctaatgtacttcaatctgggcgccttgccctggcagggcttaaaggcagccaac
aagaggcaaaagtacgagaggatctcggagaagaagctgtccacctcgattgtggtgctg
tgcaagggcttccccagcgagttcgtcaactatctgaacttctgtcgccagatgcatttc
gaccagcgtcccgattactgccacctgcgcaaactcttccgcaacttgttccaccgtttg
ggcttcacttacgactatgtgtttgactggaacctgcttaagtttggcggacctcgcaat
ccccaggcgattcagcaggcgcaggacggagcggacggccaggcgggtcatgatgcggtg
gccgcagcagcggcggtggcagcagcggcagccgcctcctcgcatcaacaacagcagcac
aaggtcaatgcggcgctgggtggcggaggaggcagtgcagcgcaacagcaactccagggc
ggccaaacgctggcgatgctgggcggcaatggaggcggtaacggcagccaactgatcggc
ggcaacggactcaacatggacgactcgatggcggccaccaactcgtcgagaccgccgtac
gacacgccggagcgtcggccttcgatacggatgcggcagggaggcggtggtggcggcggt
ggagtgggcgtaggcggtatgccgagcggcggagggggcggtggcgtggggaacgccaaa
taa

DBGET integrated database retrieval system