Drosophila melanogaster (fruit fly): Dmel_CG2248 Help Entry Dmel_CG2248       CDS       T00030                                  Symbol Rac1 Name (RefSeq) Rac1, isoform B   KO K04392   Ras-related C3 botulinum toxin substrate 1 Organism dme  Drosophila melanogaster (fruit fly) Pathway dme04013   MAPK signaling pathway - fly dme04145   Phagosome dme04148   Efferocytosis dme04310   Wnt signaling pathway Brite KEGG Orthology (KO) [BR:dme00001]  09130 Environmental Information Processing   09132 Signal transduction    04013 MAPK signaling pathway - fly     Dmel_CG2248 (Rac1)    04310 Wnt signaling pathway     Dmel_CG2248 (Rac1)  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     Dmel_CG2248 (Rac1)    04148 Efferocytosis     Dmel_CG2248 (Rac1)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:dme04131]     Dmel_CG2248 (Rac1)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:dme04147]     Dmel_CG2248 (Rac1)    04031 GTP-binding proteins [BR:dme04031]     Dmel_CG2248 (Rac1) Membrane trafficking [BR:dme04131]  Exocytosis   Small GTPases and associated proteins    Rho GTPases     Dmel_CG2248 (Rac1)  Endocytosis   Lipid raft mediated endocytosis    Arf6-dependent endocytosis     Dmel_CG2248 (Rac1)   Macropinocytosis    Ras GTPases     Dmel_CG2248 (Rac1)  Others   NADPH oxidases (Nox) and associated proteins    Nox associated proteins     Dmel_CG2248 (Rac1) Exosome [BR:dme04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    Dmel_CG2248 (Rac1)   Exosomal proteins of other body fluids (saliva and urine)    Dmel_CG2248 (Rac1)   Exosomal proteins of colorectal cancer cells    Dmel_CG2248 (Rac1)   Exosomal proteins of bladder cancer cells    Dmel_CG2248 (Rac1) GTP-binding proteins [BR:dme04031]  Small (monomeric) G-proteins   Rho Family    Rac/Cdc42 [OT]     Dmel_CG2248 (Rac1) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU Motif Other DBs NCBI-GeneID:  38146 NCBI-ProteinID:  NP_001261247 FlyBase:  FBgn0010333 UniProt:  P40792 M9PBH7 LinkDB All DBs Position 3L Genome browser AA seq 192 aa AA seqDB search MQAIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDAKPINLGLWDTAG QEDYDRLRPLSYPQTDVFLICFSLVNPASFENVRAKWYPEVRHHCPSTPIILVGTKLDLR DDKNTIEKLRDKKLAPITYPQGLAMAKEIGAVKYLECSALTQKGLKTVFDEAIRSVLCPV LQPKSKRKCALL NT seq 579 nt NT seq  +upstreamnt  +downstreamnt atgcaggcgatcaagtgcgtcgtcgtgggcgacggagccgtgggaaagacctgcctgctg atcagctacacgaccaatgcctttcccggcgagtacatacccaccgtgttcgacaactac tcggccaacgtgatggtggacgccaagcccatcaacctgggcctgtgggatacggccggg caggaggactacgaccgactgaggccactgtcttatccccagaccgatgtcttcctcatc tgcttctcgctggtgaatccggcatcgttcgagaacgtgcgggccaagtggtatccggag gtgcgccaccactgccccagcacgcccatcatcctggtgggcaccaagctggatttgcgc gacgacaagaacacaatcgaaaagctgagggacaagaaactggcgcccatcacctatccg cagggcctggccatggccaaggaaatcggagcggtcaagtatctggagtgctcggccctg acgcagaagggtctgaaaaccgttttcgacgaggccatccggtcggttttgtgccccgtg ctgcagcccaagtccaagcgcaagtgcgccctgctctaa

Drosophila melanogaster (fruit fly): Dmel_CG5588 Help Entry Dmel_CG5588       CDS       T00030                                  Symbol Mtl Name (RefSeq) Mig-2-like, isoform B   KO K04392   Ras-related C3 botulinum toxin substrate 1 Organism dme  Drosophila melanogaster (fruit fly) Pathway dme04013   MAPK signaling pathway - fly dme04145   Phagosome dme04148   Efferocytosis dme04310   Wnt signaling pathway Brite KEGG Orthology (KO) [BR:dme00001]  09130 Environmental Information Processing   09132 Signal transduction    04013 MAPK signaling pathway - fly     Dmel_CG5588 (Mtl)    04310 Wnt signaling pathway     Dmel_CG5588 (Mtl)  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     Dmel_CG5588 (Mtl)    04148 Efferocytosis     Dmel_CG5588 (Mtl)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:dme04131]     Dmel_CG5588 (Mtl)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:dme04147]     Dmel_CG5588 (Mtl)    04031 GTP-binding proteins [BR:dme04031]     Dmel_CG5588 (Mtl) Membrane trafficking [BR:dme04131]  Exocytosis   Small GTPases and associated proteins    Rho GTPases     Dmel_CG5588 (Mtl)  Endocytosis   Lipid raft mediated endocytosis    Arf6-dependent endocytosis     Dmel_CG5588 (Mtl)   Macropinocytosis    Ras GTPases     Dmel_CG5588 (Mtl)  Others   NADPH oxidases (Nox) and associated proteins    Nox associated proteins     Dmel_CG5588 (Mtl) Exosome [BR:dme04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    Dmel_CG5588 (Mtl)   Exosomal proteins of other body fluids (saliva and urine)    Dmel_CG5588 (Mtl)   Exosomal proteins of colorectal cancer cells    Dmel_CG5588 (Mtl)   Exosomal proteins of bladder cancer cells    Dmel_CG5588 (Mtl) GTP-binding proteins [BR:dme04031]  Small (monomeric) G-proteins   Rho Family    Rac/Cdc42 [OT]     Dmel_CG5588 (Mtl) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU Motif Other DBs NCBI-GeneID:  43319 NCBI-ProteinID:  NP_524533 FlyBase:  FBgn0039532 UniProt:  Q7JWS8 LinkDB All DBs Position 3R Genome browser AA seq 195 aa AA seqDB search MSTGRPIKCVVVGDGTVGKTCMLISYTTDCFPGEYVPTVFDNYSAPMQVDTIQVSLGLWD TAGQEDYDRLRPLSYPQTDVFLICYSVASPSSFENVTSKWYPEIKHHCPDAPIILVGTKI DLREDRETLSGLAEQGLTPLKREQGQKLANKIRAVKYMECSALTQRGLKPVFEEAVRAVL RPEPLKRRQRKCLIM NT seq 588 nt NT seq  +upstreamnt  +downstreamnt atgtcaaccggaaggcccataaagtgtgtagtcgttggtgacggcaccgtcggaaagacc tgcatgctaatctcctacacgacagactgctttcccggcgaatatgtgcccacagtcttc gacaactactcggcgcccatgcaagtggacacaatacaggtctcgctgggactgtgggat acggcgggtcaggaggactacgaccgcctgagaccgctatcctacccgcagacagacgtt ttcctgatatgctacagcgtggcgagtccctcgtcctttgagaacgtcacctcgaaatgg tatccggagataaagcaccactgtcccgatgcgcccatcattctagttggcaccaaaatc gatttgcgcgaagatcgagagacactcagcggcctggcagagcagggactgacgccgctg aagcgcgagcagggccagaagctggcaaacaagatacgcgctgtgaaatacatggagtgc tccgccttgacgcagcgcggtctcaagccggtgttcgaggaagcggtgcgcgcggtgctc agaccagagccgctaaagcgacgccagcgaaagtgtttaataatgtaa

Drosophila melanogaster (fruit fly): Dmel_CG8556 Help Entry Dmel_CG8556       CDS       T00030                                  Symbol Rac2 Name (RefSeq) Rac2, isoform B   KO K04392   Ras-related C3 botulinum toxin substrate 1 Organism dme  Drosophila melanogaster (fruit fly) Pathway dme04013   MAPK signaling pathway - fly dme04145   Phagosome dme04148   Efferocytosis dme04310   Wnt signaling pathway Brite KEGG Orthology (KO) [BR:dme00001]  09130 Environmental Information Processing   09132 Signal transduction    04013 MAPK signaling pathway - fly     Dmel_CG8556 (Rac2)    04310 Wnt signaling pathway     Dmel_CG8556 (Rac2)  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     Dmel_CG8556 (Rac2)    04148 Efferocytosis     Dmel_CG8556 (Rac2)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:dme04131]     Dmel_CG8556 (Rac2)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:dme04147]     Dmel_CG8556 (Rac2)    04031 GTP-binding proteins [BR:dme04031]     Dmel_CG8556 (Rac2) Membrane trafficking [BR:dme04131]  Exocytosis   Small GTPases and associated proteins    Rho GTPases     Dmel_CG8556 (Rac2)  Endocytosis   Lipid raft mediated endocytosis    Arf6-dependent endocytosis     Dmel_CG8556 (Rac2)   Macropinocytosis    Ras GTPases     Dmel_CG8556 (Rac2)  Others   NADPH oxidases (Nox) and associated proteins    Nox associated proteins     Dmel_CG8556 (Rac2) Exosome [BR:dme04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    Dmel_CG8556 (Rac2)   Exosomal proteins of other body fluids (saliva and urine)    Dmel_CG8556 (Rac2)   Exosomal proteins of colorectal cancer cells    Dmel_CG8556 (Rac2)   Exosomal proteins of bladder cancer cells    Dmel_CG8556 (Rac2) GTP-binding proteins [BR:dme04031]  Small (monomeric) G-proteins   Rho Family    Rac/Cdc42 [OT]     Dmel_CG8556 (Rac2) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU Motif Other DBs NCBI-GeneID:  38831 NCBI-ProteinID:  NP_001261517 FlyBase:  FBgn0014011 UniProt:  P48554 M9PBU2 LinkDB All DBs Position 3L Genome browser AA seq 192 aa AA seqDB search MQAIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDAKPINLGLWDTAG QEDYDRLRPLSYPQTDVFLICFSLVNPASFENVRAKWFPEVRHHCPSVPIILVGTKLDLR DDKQTIEKLKDKKLTPITYPQGLAMAKEIAAVKYLECSALTQKGLKTVFDEAIRSVLCPV VRGPKRHKCALL NT seq 579 nt NT seq  +upstreamnt  +downstreamnt atgcaggccatcaagtgtgtggttgtgggcgacggagcggtgggaaagacctgtctgctg atcagctatacgaccaacgccttccccggcgagtacatacccacggtgttcgacaactat tcggcgaatgtgatggtggatgccaagcccatcaatctgggcctctgggatacggctgga caggaggactacgatcgcctgaggccgctatcctatccgcaaacggatgtctttctcatc tgtttctcactggtgaatccggcatcgtttgagaatgtgcgagccaaatggtttcccgag gtgcgtcatcattgcccgagtgtgccgataatcctggtcggcaccaaactggatctgcgc gacgataagcagacgatcgagaagctgaaggacaagaagctaacaccgatcacctatccc caaggactggcgatggccaaggaaatagctgcggtcaagtatctggagtgctcggccctg acccaaaagggtctgaagacggtcttcgacgaggccatacgatccgtgctatgtcctgtc gttcgaggacccaagcggcacaagtgcgccctgctctaa

Drosophila melanogaster (fruit fly): Dmel_CG9366 Help Entry Dmel_CG9366       CDS       T00030                                  Symbol RhoL Name (RefSeq) Rho-like, isoform A   KO K04392   Ras-related C3 botulinum toxin substrate 1 Organism dme  Drosophila melanogaster (fruit fly) Pathway dme04013   MAPK signaling pathway - fly dme04145   Phagosome dme04148   Efferocytosis dme04310   Wnt signaling pathway Brite KEGG Orthology (KO) [BR:dme00001]  09130 Environmental Information Processing   09132 Signal transduction    04013 MAPK signaling pathway - fly     Dmel_CG9366 (RhoL)    04310 Wnt signaling pathway     Dmel_CG9366 (RhoL)  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     Dmel_CG9366 (RhoL)    04148 Efferocytosis     Dmel_CG9366 (RhoL)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:dme04131]     Dmel_CG9366 (RhoL)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:dme04147]     Dmel_CG9366 (RhoL)    04031 GTP-binding proteins [BR:dme04031]     Dmel_CG9366 (RhoL) Membrane trafficking [BR:dme04131]  Exocytosis   Small GTPases and associated proteins    Rho GTPases     Dmel_CG9366 (RhoL)  Endocytosis   Lipid raft mediated endocytosis    Arf6-dependent endocytosis     Dmel_CG9366 (RhoL)   Macropinocytosis    Ras GTPases     Dmel_CG9366 (RhoL)  Others   NADPH oxidases (Nox) and associated proteins    Nox associated proteins     Dmel_CG9366 (RhoL) Exosome [BR:dme04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    Dmel_CG9366 (RhoL)   Exosomal proteins of other body fluids (saliva and urine)    Dmel_CG9366 (RhoL)   Exosomal proteins of colorectal cancer cells    Dmel_CG9366 (RhoL)   Exosomal proteins of bladder cancer cells    Dmel_CG9366 (RhoL) GTP-binding proteins [BR:dme04031]  Small (monomeric) G-proteins   Rho Family    Rac/Cdc42 [OT]     Dmel_CG9366 (RhoL) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU Motif Other DBs NCBI-GeneID:  41136 NCBI-ProteinID:  NP_524292 FlyBase:  FBgn0014380 UniProt:  Q24192 LinkDB All DBs Position 3R Genome browser AA seq 190 aa AA seqDB search MTANITKSPRPLKITIVGDGMVGKTCMLITYTRNEFPEEYIPTVFDNHACNIAVDDRDYN LTLWDTAGQEDYERLRPLSYPSTNCFLLCYSISSRTSFENVKSKWWPEIRHFSAHVPVVL VGTKLDLRIPNSEKFVTTQEGKKMRKEIHAFNLVECSAKKKQNLQQVFEEAVRAVERKPK TTSKQSCKIL NT seq 573 nt NT seq  +upstreamnt  +downstreamnt atgacggcgaacataacgaagagtccgcgcccgctgaaaataaccatcgtgggcgatggc atggtgggcaaaacctgcatgctgataacctacacacggaacgagttccccgaggagtac atacccacagtgttcgacaatcacgcctgcaacatagccgtagatgatcgggactacaat ctgaccctctgggacactgccggccaggaggattacgaaaggctgcgccccctgagctat cccagtaccaactgcttcctgttgtgctattcgatcagcagtaggacctcattcgaaaac gtgaaaagcaagtggtggccggagatccgtcacttctccgcccacgttcccgtggttctc gtgggcaccaaactggacttgcgcattcccaactcggagaagttcgtgaccacacaggag ggaaaaaagatgcgcaaagagatacacgcattcaacttggtcgagtgctccgccaagaag aagcagaacctgcagcaggtcttcgaggaggcggttagagccgtggagaggaaaccaaag acgacgtccaagcaatcgtgcaaaatactgtga

DBGET integrated database retrieval system