KEGG   Drosophila melanogaster (fruit fly): Dmel_CG2621
Entry
Dmel_CG2621       CDS       T00030                                 
Symbol
sgg
Name
(RefSeq) shaggy, isoform B
  KO
K03083  glycogen synthase kinase 3 beta [EC:2.7.11.26]
Organism
dme  Drosophila melanogaster (fruit fly)
Pathway
dme04150  mTOR signaling pathway
dme04310  Wnt signaling pathway
dme04341  Hedgehog signaling pathway - fly
dme04711  Circadian rhythm - fly
Brite
KEGG Orthology (KO) [BR:dme00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    Dmel_CG2621 (sgg)
   04341 Hedgehog signaling pathway - fly
    Dmel_CG2621 (sgg)
   04150 mTOR signaling pathway
    Dmel_CG2621 (sgg)
 09150 Organismal Systems
  09159 Environmental adaptation
   04711 Circadian rhythm - fly
    Dmel_CG2621 (sgg)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:dme01001]
    Dmel_CG2621 (sgg)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:dme03036]
    Dmel_CG2621 (sgg)
Enzymes [BR:dme01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.26  tau-protein kinase
     Dmel_CG2621 (sgg)
Protein kinases [BR:dme01001]
 Serine/threonine kinases: CMGC group
  GSK family [OT]
   Dmel_CG2621 (sgg)
Chromosome and associated proteins [BR:dme03036]
 Eukaryotic type
  Centrosome formation proteins
   Kinases and associated factors
    Dmel_CG2621 (sgg)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kinase-like ABC1 APH Kdo Choline_kinase FTA2
Other DBs
NCBI-GeneID: 31248
NCBI-ProteinID: NP_476715
FlyBase: FBgn0003371
UniProt: P18431 A4V3W2
LinkDB
Position
X:2633952..2679553
AA seq 514 aa
MSGRPRTSSFAEGNKQSPSLVLGGVKTCSRDGSKITTVVATPGQGTDRVQEVSYTDTKVI
GNGSFGVVFQAKLCDTGELVAIKKVLQDRRFKNRELQIMRKLEHCNIVKLLYFFYSSGEK
RDEVFLNLVLEYIPETVYKVARQYAKTKQTIPINFIRLYMYQLFRSLAYIHSLGICHRDI
KPQNLLLDPETAVLKLCDFGSAKQLLHGEPNVSYICSRYYRAPELIFGAINYTTKIDVWS
AGCVLAELLLGQPIFPGDSGVDQLVEVIKVLGTPTREQIREMNPNYTEFKFPQIKSHPWQ
KVFRIRTPTEAINLVSLLLEYTPSARITPLKACAHPFFDELRMEGNHTLPNGRDMPPLFN
FTEHELSIQPSLVPQLLPKHLQNASGPGGNRPSAGGAASIAASGSTSVSSTGSGASVEGS
AQPQSQGTAAAAGSGSGGATAGTGGASAGGPGSGNNSSSGGASGAPSAVAAGGANAAVAG
GAGGGGGAGAATAAATATGAIGATNAGGANVTDS
NT seq 1545 nt   +upstreamnt  +downstreamnt
atgagcggtcgtccaagaacttcctccttcgccgagggcaacaaacagtcgccgagtttg
gtgctgggcggcgtcaaaacatgcagtcgcgatggttctaaaatcacaacagttgttgca
acacccggccaaggcaccgatcgcgtacaagaggtctcctatacagacacaaaggtcatc
ggcaatggcagcttcggcgtcgtgttccaggcaaagctctgcgataccggcgaactggtg
gcaatcaaaaaagttttacaagacagacgatttaagaatcgcgaattgcaaataatgcgc
aaattggagcattgtaatattgtgaagcttttgtactttttctattcgagtggtgaaaag
cgtgatgaagtatttttgaatttagtcctcgaatatataccagaaaccgtatacaaagtg
gctcgccaatatgccaaaaccaagcaaacgataccaatcaactttattcggctctacatg
tatcaactgttcagaagtttggcctacatccactcgctgggcatttgccatcgtgatatc
aagccgcagaatcttctgctcgatccggagacggctgtgctgaagctctgtgactttggc
agcgccaaacagctgctgcacggcgagccgaatgtatcgtatatctgctcccggtattac
cgcgcccccgagctcatctttggcgccatcaattatacaacaaagatcgatgtctggagt
gccggttgcgttttggccgaactgctgctgggccagcccatcttccctggcgattccggt
gtggatcagctcgtcgaggtcatcaaggtcctgggcacaccgacaagagaacagatacgc
gaaatgaatccaaactacacggaattcaagttccctcagattaagagtcatccatggcag
aaagttttccgtatacgcactcctacagaagctatcaacttggtgtccctgctgctcgag
tatacgcccagtgccaggatcacaccgctcaaggcctgcgcacatccgttcttcgatgag
ctacgcatggagggtaatcacaccttgcccaacggtcgcgatatgccgccgctgttcaac
ttcacagagcatgagctctcaatacagcccagcctagtgccgcagttgttgcccaagcat
ctgcagaacgcatccggacctggcggcaatcgaccctcggccggcggagcagcctccatt
gcggccagcggctccaccagcgtctcgtcaacgggcagtggtgcctcggtggaaggatcc
gcccagccacagtcgcagggtacagcagcagctgcgggatccggatcgggcggagcaaca
gcaggaaccggcggagcgagtgccggtggacccggatctggtaacaacagtagcagcggc
ggagcatcgggagcgccgtccgctgtggctgccggaggagccaatgccgccgtcgctggc
ggtgctggtggtggtggcggagccggtgcggcgaccgcagctgcaacagcaactggcgct
ataggcgcgactaatgccggcggcgccaatgtaacagattcatag

KEGG   Drosophila melanogaster (fruit fly): Dmel_CG31003
Entry
Dmel_CG31003      CDS       T00030                                 
Symbol
gskt
Name
(RefSeq) gasket
  KO
K03083  glycogen synthase kinase 3 beta [EC:2.7.11.26]
Organism
dme  Drosophila melanogaster (fruit fly)
Pathway
dme04150  mTOR signaling pathway
dme04310  Wnt signaling pathway
dme04341  Hedgehog signaling pathway - fly
dme04711  Circadian rhythm - fly
Brite
KEGG Orthology (KO) [BR:dme00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    Dmel_CG31003 (gskt)
   04341 Hedgehog signaling pathway - fly
    Dmel_CG31003 (gskt)
   04150 mTOR signaling pathway
    Dmel_CG31003 (gskt)
 09150 Organismal Systems
  09159 Environmental adaptation
   04711 Circadian rhythm - fly
    Dmel_CG31003 (gskt)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:dme01001]
    Dmel_CG31003 (gskt)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:dme03036]
    Dmel_CG31003 (gskt)
Enzymes [BR:dme01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.26  tau-protein kinase
     Dmel_CG31003 (gskt)
Protein kinases [BR:dme01001]
 Serine/threonine kinases: CMGC group
  GSK family [OT]
   Dmel_CG31003 (gskt)
Chromosome and associated proteins [BR:dme03036]
 Eukaryotic type
  Centrosome formation proteins
   Kinases and associated factors
    Dmel_CG31003 (gskt)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kdo ABC1 Kinase-like APH Choline_kinase
Other DBs
NCBI-GeneID: 318552
NCBI-ProteinID: NP_733426
FlyBase: FBgn0046332
UniProt: P83101
LinkDB
Position
3R
AA seq 501 aa
MASQSKNSGLTNKVTTVVATNAFGADVMSEISYTDAKVVGNGSFGVVFQAKMVPSNEMVA
IKKVLQDRRFKNRELQIMRKLRHDNIITLKWFFFSSGEKRDEVYLNLVMEFLPETLYKVE
RQYARAKQTLPVNFVRLYMYQLLRSMGYLHSLGFCHRDIKPQNMLLDSETGVLKLCDFGS
AKQLISGEPNVSYICSRYYRAPELIFGSTDYTTKIDMWSAGCVMSELLLGQLIFPGDSGV
DQIVEIVKVMGTPTSEQLHDMNPHYKQFKLPELKPHPWSKVFRIRTPAEAIDLVSKMLIY
SPNARVSPLMGCAHPFFDELRQDPHQQLPNGRSLPPLFNFTDYEKTIEPDTMPLLLPRAQ
GSSTTKEPSAAHRNRNTAGEESPRKTEDSQKPATAALSKSPGPSGKALESPPGFLQHDLG
NGDHVAVGTMPMEPLTLEQNHFAAESYAVGEDAEDNLEEDVGDENDYDYDDGGQCNSTYI
SDDMDEASESDDDDFEEEDEN
NT seq 1506 nt   +upstreamnt  +downstreamnt
atggcttcccagagtaagaacagtgggttgaccaacaaggtgaccacggtggtggccacc
aatgccttcggcgctgatgtgatgagcgagatcagctacacggacgcgaaagttgtgggc
aatggcagcttcggcgtggtcttccaggccaaaatggtgcccagcaacgaaatggtggcc
ataaagaaggtcctgcaggatcggcgcttcaagaatcgggaactgcaaatcatgcgcaag
ctgcgccacgataacatcataactctcaagtggttcttcttttcaagtggcgagaaaagg
gacgaggtctatctgaacctggtcatggagttcttgccggagacgctgtataaagtggag
cgacagtacgcaagggcaaagcaaaccttgccagttaactttgtccgactttacatgtac
cagctgctgaggagcatgggatatctccacagcttgggattctgtcacagggacatcaag
ccgcagaacatgctgctcgattcggagacgggtgtgcttaagctctgcgatttcggcagt
gccaagcagctgatctccggcgaacccaatgtctcgtacatctgctcaaggtactatcgt
gcgcctgagctaatttttggctccactgactataccaccaagatcgatatgtggagcgcc
gggtgtgtgatgtcagagttgctgctgggccagctcatctttcccggggactcgggagtg
gaccagattgtagagatcgtcaaggttatgggcactcccacctcggagcagctccatgac
atgaatccgcattacaagcagttcaagttgccggaactgaagccgcacccctggtccaag
gtgttcaggattcgcacaccggcggaggccatagatctggtctccaagatgctgatatac
tcgcccaatgccagggtttctccgttgatgggctgtgcccatccgttcttcgacgaactt
cgtcaggatccacaccagcagttgcccaacggcaggagcttgccgccgctgtttaacttt
acagactatgagaaaaccatcgagccggatacaatgccgctgctgctgccgcgggctcag
ggttccagcaccaccaaggagccaagtgctgcccacaggaaccgcaatacagccggggag
gagagccctcggaaaacggaggacagccaaaaaccggcgacagcagcgctctcaaagtcc
cctggaccttcgggcaaggcgctcgaatccccgccaggctttttgcaacacgatttggga
aacggcgaccatgtggctgtgggcaccatgccaatggagcccctgaccctggagcagaac
cacttcgcagcagagagctatgcagtcggcgaggatgccgaggataatttagaagaggat
gtcggtgatgaaaacgactatgactacgatgatggtgggcagtgcaatagcacctacatc
agcgacgacatggatgaggcctccgagtcggatgacgacgatttcgaggaagaggatgaa
aactaa

DBGET integrated database retrieval system