Drosophila melanogaster (fruit fly): Dmel_CG31275 Help Entry Dmel_CG31275      CDS       T00030                                  Symbol CG31275 Name (RefSeq) uncharacterized protein   KO K10419   dynein light chain roadblock-type Organism dme  Drosophila melanogaster (fruit fly) Pathway dme04814   Motor proteins Brite KEGG Orthology (KO) [BR:dme00001]  09140 Cellular Processes   09142 Cell motility    04814 Motor proteins     Dmel_CG31275 (CG31275)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:dme04131]     Dmel_CG31275 (CG31275)   09183 Protein families: signaling and cellular processes    03037 Cilium and associated proteins [BR:dme03037]     Dmel_CG31275 (CG31275)    04812 Cytoskeleton proteins [BR:dme04812]     Dmel_CG31275 (CG31275) Membrane trafficking [BR:dme04131]  Endosome - Golgi transport   Rab GTPases and associated proteins    Rab associated proteins     Dmel_CG31275 (CG31275) Cilium and associated proteins [BR:dme03037]  Motile cilia and associated proteins   Dynein arm    Dmel_CG31275 (CG31275) Cytoskeleton proteins [BR:dme04812]  Eukaryotic cytoskeleton proteins   Microtubules    Tubulin-binding proteins     Dyneins      Dmel_CG31275 (CG31275) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Other DBs NCBI-GeneID:  326131 NCBI-ProteinID:  NP_732175 FlyBase:  FBgn0063261 UniProt:  Q7JQ02 LinkDB All DBs Position 3R Genome browser AA seq 101 aa AA seqDB search MNRILEKVIHQNGTIVDRILSEHTIGYVVSDNTANAVAETSFDNTSAQAILKHLHGLLVS TCQSVVRDIDPSNKLCFMRLGTRKFEYLVAPEEYFTITVVQ NT seq 306 nt NT seq  +upstreamnt  +downstreamnt atgaatcgcattctcgagaaggtgattcaccagaatggaacaatcgtggatcgcattcta tcggaacatactattgggtatgtggtgtccgataacacagccaatgcggtggccgaaaca tccttcgataacacaagtgcccaggcgatcctgaagcacttacatggactcctggtgagc acctgccaaagcgtagtccgggacattgacccgtccaacaaactctgcttcatgcgcctg ggcactcgcaagttcgagtatctggtggccccagaggagtacttcaccattacagtggtt caatga

DBGET integrated database retrieval system