Drosophila melanogaster (fruit fly): Dmel_CG32268 Help Entry Dmel_CG32268      CDS       T00030                                  Symbol Drsl6 Name (RefSeq) Drosomycin-like 6   KO K20670   drosomycin Organism dme  Drosophila melanogaster (fruit fly) Pathway dme04624   Toll and Imd signaling pathway Brite KEGG Orthology (KO) [BR:dme00001]  09150 Organismal Systems   09151 Immune system    04624 Toll and Imd signaling pathway     Dmel_CG32268 (Drsl6)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    02000 Transporters [BR:dme02000]     Dmel_CG32268 (Drsl6) Transporters [BR:dme02000]  Other transporters   Accessory factors involved in transport [TC:8]    Dmel_CG32268 (Drsl6) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Gamma-thionin AtDEF-like Toxin_3 Motif Other DBs NCBI-GeneID:  38416 NCBI-ProteinID:  NP_728873 FlyBase:  FBgn0052268 UniProt:  Q9VZQ4 LinkDB All DBs Position 3L Genome browser AA seq 72 aa AA seqDB search MMQIKFLFTFLALLMMVILGAKEADADCLSGRYRGPCAVWDNETCRRVCREEGRGRVSGH CSARLQCWCEGC NT seq 219 nt NT seq  +upstreamnt  +downstreamnt atgatgcaaatcaagttcctgttcaccttcctcgctctgctgatgatggtcatcctgggc gccaaggaagccgatgccgactgcctttccggaaggtacagaggtccctgtgccgtctgg gacaacgagacatgcaggcgggtttgccgagaggagggacgaggacgagtgagtggtcac tgcagtgccaggctgcaatgctggtgcgaaggatgctga

DBGET integrated database retrieval system