KEGG   Drosophila melanogaster (fruit fly): Dmel_CG3234
Entry
Dmel_CG3234       CDS       T00030                                 
Symbol
tim
Name
(RefSeq) timeless, isoform P
  KO
K12074  timeless
Organism
dme  Drosophila melanogaster (fruit fly)
Pathway
dme04711  Circadian rhythm - fly
Brite
KEGG Orthology (KO) [BR:dme00001]
 09150 Organismal Systems
  09159 Environmental adaptation
   04711 Circadian rhythm - fly
    Dmel_CG3234 (tim)
SSDB
Motif
Pfam: TIMELESS TIMELESS_C DUF261
Other DBs
NCBI-GeneID: 33571
NCBI-ProteinID: NP_722912
FlyBase: FBgn0014396
UniProt: P49021
LinkDB
Position
2L
AA seq 1398 aa
MDWLLATPQLYSAFSSLGCLEGDTYVVNPNALAILEEINYKLTYEDQTLRTFRRAIGFGQ
NVRSDLIPLLENAKDDAVLESVIRILVNLTVPVECLFSVDVMYRTDVGRHTIFELNKLLY
TSKEAFTEARSTKSVVEYMKHILESDPKLSPHKCDQINNCLLLLRNILHIPETHAHCVMP
MMQSMPHGISMQNTILWNLFIQSIDKLLLYLMTCPQRAFWGVTMVQLIALIYKDQHVSTL
QKLLSLWFEASLSESSEDNESNTSPPKQGSGDSSPMLTSDPTSDSSDNGSNGRGMGGGMR
EGTAATLQEVSRKGQEYQNAMARVPADKPDGSEEASDMTGNDSEQPGSPEQSQPAGESMD
DGDYEDQRHRQLNEHGEEDEDEDEVEEEEYLQLGPASEPLNLTQQPADKVNNTTNPTSSA
PQGCLGNEPFKPPPPLPVRASTSAHAQMQKFNESSYASHVSAVKLGQKSPHAGQLQLTKG
KCCPQKRECPSSQSELSDCGYGTQVENQESISTSSNDDDGPQGKPQHQKPPCNTKPRNKP
RTIMSPMDKKELRRKKLVKRSKSSLINMKGLVQHTPTDDDISNLLKEFTVDFLLKGYSYL
VEELHMQLLSNAKVPIDTSHFFWLVTYFLKFAAQLELDMEHIDTILTYDVLSYLTYEGVS
LCEQLELNARQEGSDLKPYLRRMHLVVTAIREFLQAIDTYNKVTHLNEDDKAHLRQLQLQ
ISEMSDLRCLFVLLLRRFNPSIHSKQYLQDLVVTNHILLLILDSSAKLGGCQTIRLSEHI
TQFATLEVMHYYGILLEDFNNNGEFVNDCIFTMMHHIGGDLGQIGVLFQPIILKTYSRIW
EADYELCDDWSDLIEYVIHKFMNTPPKSPLTIPTTSLTEMTKEHNQEHTVCSWSQEEMDT
LYWYYVQSKKNNDIVGKIVKLFSNNGNKLKTRISIIQQLLQQDIITLLEYDDLMKFEDAE
YQRTLLTTPTSATTESGIEIKECAYGKPSDDVQILLDLIIKENKAQHLLWLQRILIECCF
VKLTLRSGLKVPEGDHIMEPVAYHCICKQKSIPVVQWNNEQSTTMLYQPFVLLLHKLGIQ
LPADAGSIFARIPDYWTPETMYGLAKKLGPLDKLNLKFDASELEDATASSPSRYHHTGPR
NSLSSVSSLDVDLGDTEELALIPEVDAAVEKAHAMASTPSPSEIFAVPKTKHCNSIIRYT
PDPTPPVPNWLQLVMRSKCNHRTGPSGDPSDCIGSSSTTVDDEGFGKSISAATSQAASTS
MSTVNPTTTLSLNMLNTFMGSHNENSSSSGCGGTVSSLSMVALMSTGAAGGGGNTSGLEM
DVDASMKSSFERLEVNGSHFSRANNLDQEYSAMVASVYEKEKELNSDNVSLASDLTRMYV
SDEDDRLERTEIRVPHYH
NT seq 4197 nt   +upstreamnt  +downstreamnt
atggactggttactagcaactccgcagttgtacagcgcgttctcctccttgggttgcttg
gagggcgatacctatgtggtcaacccgaatgcattggccattctggaggagatcaactac
aagctcacctatgaggaccaaacactgcgcacctttcgacgggccattggatttggccag
aatgtgaggtcagacctgataccgctgctggagaatgccaaggatgatgcggtcctggag
tcggtcatccggatactcgtcaatctgacggtgccggtggagtgcctcttctccgtggac
gtgatgtaccgcacggatgtgggtcgccacaccatcttcgagctgaacaagctgctgtac
accagcaaggaagcatttaccgaggccaggagcaccaagagcgtggtggagtacatgaaa
cacatactggagtcggaccctaagctgtcgccgcacaaatgcgatcaaatcaacaactgt
ctgctgctgctgagaaatatcctgcacattccagagacgcatgcccattgcgtgatgccc
atgatgcagtcgatgccgcatggcatctccatgcagaacacgatcttgtggaatctcttc
atccagagcatcgacaagttactcctgtatctgatgacctgtccgcagagagccttctgg
ggagtgaccatggtgcaactgattgctttgatctacaaggatcagcatgtgagcactctg
caaaaactacttagcctctggttcgaagcctctctgtcggagagctctgaggataatgag
agtaatacctcgccccccaaacagggcagtggcgattccagccccatgctgacctctgat
cctacctctgattcctcggacaatggcagcaatggccgtggcatgggcggtggcatgcgg
gaaggaacagcggccactttgcaggaggtgagccgcaagggtcaggagtatcagaacgcc
atggccagagtgccagcggataagcccgatggctccgaagaggccagcgatatgacgggg
aacgacagcgagcagcctggatcgccggagcaatcgcagcccgccggcgagtccatggac
gatggagattacgaggaccagagacacaggcaactgaacgagcatggcgaggaggatgaa
gatgaggacgaagtggaggaggaagagtacctacaattgggcccagcctcggagccccta
aacttaacacaacaaccagctgacaaggtcaacaacactaccaacccaacgtccagtgcg
ccacaaggctgcctgggcaatgagccattcaagccaccacctcctctgccagtcagagcc
tccacctcggcacacgctcaaatgcagaagttcaacgaatcgtcctacgcgtcccacgta
tctgcggtcaaattgggccaaaagtccccacatgccggccagctccagctgaccaagggc
aagtgttgcccacagaagcgggaatgcccctcctcgcagtcggagctatcggattgcggt
tatggcacccaggtggaaaatcaggaatccatttccacctccagcaacgacgatgatggg
ccgcagggcaagccgcagcaccagaagcctccgtgtaacacgaagccacggaataaacca
cggacgattatgtcgccaatggacaaaaaggagcttagacgcaaaaaactggtcaagcgc
agcaaaagcagcctcatcaacatgaagggtctggtacagcacacccccaccgatgatgac
atctccaatctgctgaaggaattcaccgtggatttcctcctcaagggttacagctatctg
gtggaggaactgcacatgcaactgctttccaatgcgaaggtgcccattgacacatcgcac
ttcttctggctggtcacctacttcctgaagtttgccgcccaactggagctggatatggag
cacatcgacactattctcacctacgatgttttgagctacttgacctatgagggtgtgtcc
ctatgtgagcaactggaactgaatgcccgacaggagggcagtgacctgaagccctatcta
aggcgaatgcacttggtggtgacggccatccgggagttcctccaggccattgatacgtac
aacaaagtgactcatctgaacgaggacgacaaagcccatttgaggcagcttcagctgcag
attagcgaaatgtccgatctgaggtgcctttttgtgcttctgctgaggcgtttcaatccc
agcattcattccaagcagtatcttcaggatctggtggttaccaatcacatcctcctactc
attctggacagttcggccaaacttggtggatgtcaaaccattcgcctgtcggagcacata
acacagtttgccacgctggaggtgatgcactactatggcattctgttggaggacttcaac
aacaacggagagtttgtcaatgactgcatcttcaccatgatgcatcacatcggtggcgat
ctgggccagattggggttctatttcaaccaattattttgaaaacctattcaagaatttgg
gaagcggactatgaactgtgcgatgactggtctgatcttatcgagtatgtgattcacaag
ttcatgaatactcctccgaagtcgccactcaccattcctacaacttccttgacggaaatg
accaaggaacacaaccaggagcataccgtttgctcttggtcgcaggaggaaatggacaca
ctttattggtattatgtgcagagcaagaagaacaacgatattgtgggaaagatagttaag
ctcttcagcaacaacggcaacaagctgaaaaccaggatttctattatccaacaacttttg
caacaagacattatcaccctgttggaatacgatgacctgatgaagttcgaggatgcggag
tatcagagaactttgctgacaactcccacttccgcaacaacagagtctggaattgagatt
aaggagtgcgcctacggcaaaccctcagatgatgttcagatcctgctggacctgatcatt
aaggaaaacaaggcgcagcatttgttatggctgcaaaggatcctcattgagtgctgcttc
gttaaactgaccctgcggagtggtctcaaggttccggaaggcgatcacatcatggagccg
gtggcctaccactgcatctgcaagcagaagtccattccggtggtgcagtggaacaacgag
caatccactacgatgctgtaccagccttttgttctcctgctccacaagctgggcattcag
ctgccggcggacgcgggctcgatcttcgccagaattccggactactggacaccggagaca
atgtacggactcgccaaaaagctgggaccgctggacaaactcaacctcaagttcgacgcc
agtgaactggaggatgcgacggcgtcgagtccgtcgcgttaccaccacaccggaccccgc
aactcgctcagctcggtaagcagcctggacgtggatctcggcgataccgaggagctggcc
cttatacccgaggtggatgcggccgtggagaaggcacacgccatggcatccacgccatcg
cccagcgagattttcgcggttcccaagacgaagcactgcaactcgatcatcagatacaca
ccagatcccacgcctccagtgcccaactggctgcagttggtcatgcgcagcaaatgcaat
catcgcacaggtccgtctggtgatcccagcgattgcattggctcctcgtcgacaaccgtg
gacgatgagggatttggcaagtccatcagtgcagccacttcgcaggcggcgagcacctcc
atgagcacggttaatcccacaaccactttgagcctgaacatgctaaacaccttcatggga
agccacaacgagaacagcagcagttctggttgcgggggcaccgtctcctccctgtccatg
gtggctctgatgagcaccggcgcggcaggcggaggaggtaacacctccgggctggaaatg
gatgtggacgcctccatgaagtcctcgttcgagcggctggaggtaaacggatcgcacttc
tcgcgggccaacaacttggaccaggagtacagtgccatggtggcatctgtgtacgaaaag
gagaaggaattaaacagcgacaatgtctctttggcctcggacctgaccagaatgtatgtg
agcgatgaggacgatcgacttgagcgaaccgagatccgggtgccccactatcactga

DBGET integrated database retrieval system