Drosophila melanogaster (fruit fly): Dmel_CG32672 Help Entry Dmel_CG32672      CDS       T00030                                  Symbol Atg8a Name (RefSeq) Autophagy-related 8a, isoform B   KO K08341   GABA(A) receptor-associated protein Organism dme  Drosophila melanogaster (fruit fly) Pathway dme04068   FoxO signaling pathway dme04136   Autophagy - other dme04137   Mitophagy - animal dme04140   Autophagy - animal Brite KEGG Orthology (KO) [BR:dme00001]  09130 Environmental Information Processing   09132 Signal transduction    04068 FoxO signaling pathway     Dmel_CG32672 (Atg8a)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     Dmel_CG32672 (Atg8a)    04136 Autophagy - other     Dmel_CG32672 (Atg8a)    04137 Mitophagy - animal     Dmel_CG32672 (Atg8a)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:dme04131]     Dmel_CG32672 (Atg8a)    04121 Ubiquitin system [BR:dme04121]     Dmel_CG32672 (Atg8a)    03029 Mitochondrial biogenesis [BR:dme03029]     Dmel_CG32672 (Atg8a) Membrane trafficking [BR:dme04131]  Autophagy   Autophagosome formation proteins    Atg8 conjugation proteins     Dmel_CG32672 (Atg8a) Ubiquitin system [BR:dme04121]  Ubiquitins and ubiquitin-like proteins   Ubiquitin-like proteins (UBLs)    Dmel_CG32672 (Atg8a) Mitochondrial biogenesis [BR:dme03029]  Mitochondrial quality control factors   Mitophagy factors    Autophagy-related proteins     Dmel_CG32672 (Atg8a) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ATG8 APG12 Motif Other DBs NCBI-GeneID:  32001 NCBI-ProteinID:  NP_001285087 FlyBase:  FBgn0052672 UniProt:  X2JJA8 LinkDB All DBs Position X:complement(10764878..10768338) Genome browser AA seq 96 aa AA seqDB search MENRKVIVEKAPKARIGDLDKKKYLVPSDLTVGQFYFLIRKRIHLRPEDALFFFVNNVIP PTSATMGSLYQEHHEEDYFLYIAYSDENVYGMAKIN NT seq 291 nt NT seq  +upstreamnt  +downstreamnt atggaaaacagaaaggtcatcgtcgagaaggctcccaaggcgcgcatcggtgatttggac aagaagaagtacctggtgccttccgacctgaccgtcggtcagttctacttcctcattcgc aagcgcatccacctgcgtcccgaggatgccctcttcttctttgtgaacaacgtcattcca ccaacatcggctaccatgggctccctgtaccaggaacatcacgaggaggactatttcctg tacattgcctactccgatgagaatgtttacggcatggccaaaattaactaa

DBGET integrated database retrieval system