Drosophila melanogaster (fruit fly): Dmel_CG33177 Help Entry Dmel_CG33177      CDS       T00030                                  Symbol CG33177 Name (RefSeq) uncharacterized protein   KO K00799   glutathione S-transferase [EC:2.5.1.18] Organism dme  Drosophila melanogaster (fruit fly) Pathway dme00480   Glutathione metabolism dme00980   Metabolism of xenobiotics by cytochrome P450 dme00982   Drug metabolism - cytochrome P450 dme00983   Drug metabolism - other enzymes dme01100   Metabolic pathways Brite KEGG Orthology (KO) [BR:dme00001]  09100 Metabolism   09106 Metabolism of other amino acids    00480 Glutathione metabolism     Dmel_CG33177 (CG33177)   09111 Xenobiotics biodegradation and metabolism    00980 Metabolism of xenobiotics by cytochrome P450     Dmel_CG33177 (CG33177)    00982 Drug metabolism - cytochrome P450     Dmel_CG33177 (CG33177)    00983 Drug metabolism - other enzymes     Dmel_CG33177 (CG33177)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    02000 Transporters [BR:dme02000]     Dmel_CG33177 (CG33177) Enzymes [BR:dme01000]  2. Transferases   2.5  Transferring alkyl or aryl groups, other than methyl groups    2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)     2.5.1.18  glutathione transferase      Dmel_CG33177 (CG33177) Transporters [BR:dme02000]  Other transporters   Pores ion channels [TC:1]    Dmel_CG33177 (CG33177) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MAPEG Motif Other DBs NCBI-GeneID:  32438 NCBI-ProteinID:  NP_788903 FlyBase:  FBgn0053177 UniProt:  Q86B54 LinkDB All DBs Position X:15081367..15082369 Genome browser AA seq 167 aa AA seqDB search MDNGPMDATPTAAAFRLILLSKSNPVMGCYMFWTSLLVLKMLVMSLLTARQRMKTKTYAN PEDLRLSRSTEVRFGDPNVERVRRAHRNDLENILPFLLMSLAYVASGPNPLTARLLIRIG ASARLIHTVVYAIIPVPQPARALAFFTTFAITCFEAGYVLVCCIKYI NT seq 504 nt NT seq  +upstreamnt  +downstreamnt atggacaacggaccgatggatgccacgcccactgccgccgccttccggctgattttgctt agcaaatcgaatcccgtgatgggttgctacatgttctggaccagtctgctcgtgctgaag atgctcgttatgtcactactcaccgcccgccagcgcatgaaaaccaagacctatgccaac ccagaggatttacgcctgagtcggagcacggaggttcgattcggggatcccaatgtggaa cgagttcgtcgtgctcatcgcaacgacctagagaacattttgccctttcttctgatgtcg ctggcctatgtggccagcggaccgaatcccctgaccgcccgtctgctcatccggatcggt gcaagtgcccggctgatccacacggtggtctacgccatcatcccggttccgcagccagca agagccctggccttcttcaccaccttcgccatcacctgcttcgaggcgggctacgtgctc gtctgctgtatcaagtacatttag

DBGET integrated database retrieval system