KEGG   Drosophila melanogaster (fruit fly): Dmel_CG3412
Entry
Dmel_CG3412       CDS       T00030                                 

Gene name
slmb
Definition
(RefSeq) supernumerary limbs, isoform C
  KO
K03362  F-box and WD-40 domain protein 1/11
Organism
dme  Drosophila melanogaster (fruit fly)
Pathway
dme04120  Ubiquitin mediated proteolysis
dme04310  Wnt signaling pathway
dme04341  Hedgehog signaling pathway - fly
dme04624  Toll and Imd signaling pathway
Brite
KEGG Orthology (KO) [BR:dme00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    Dmel_CG3412 (slmb)
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    Dmel_CG3412 (slmb)
   04341 Hedgehog signaling pathway - fly
    Dmel_CG3412 (slmb)
 09150 Organismal Systems
  09151 Immune system
   04624 Toll and Imd signaling pathway
    Dmel_CG3412 (slmb)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:dme04121]
    Dmel_CG3412 (slmb)
   03036 Chromosome and associated proteins [BR:dme03036]
    Dmel_CG3412 (slmb)
Ubiquitin system [BR:dme04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   SCF complex
    Target recognizing subunit (F-box)
     Dmel_CG3412 (slmb)
Chromosome and associated proteins [BR:dme03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Centrosome duplication proteins
    Regulators of centriole replication
     Dmel_CG3412 (slmb)
SSDB
Motif
Pfam: WD40 Beta-TrCP_D ANAPC4_WD40 F-box-like WD40_like Nup160 F-box DUF6188
Other DBs
NCBI-GeneID: 42504
NCBI-ProteinID: NP_001262801
FlyBase: FBgn0283468
UniProt: Q9VDE3
LinkDB
Position
3R
AA seq 510 aa
MMKMETDKIMDETNSNAQAFTTTMLYDPVRKKDSSPTYQTERELCFQYFTQWSESGQVDF
VEHLLSRMCHYQHGQINAYLKPMLQRDFITLLPIKGLDHIAENILSYLDAESLKSSELVC
KEWLRVISEGMLWKKLIERKVRTDSLWRGLAERRNWMQYLFKPRPGQTQRPHSFHRELFP
KIMNDIDSIENNWRTGRHMLRRINCRSENSKGVYCLQYDDGKIVSGLRDNTIKIWDRTDL
QCVKTLMGHTGSVLCLQYDDKVIISGSSDSTVRVWDVNTGEMVNTLIHHCEAVLHLRFNN
GMMVTCSKDRSIAVWDMTSPSEITLRRVLVGHRAAVNVVDFDEKYIVSASGDRTIKVWST
SSCEFVRTLNGHKRGIACLQYRDRLVVSGSSDNSIRLWDIECGACLRVLEGHEELVRCIR
FDTKRIVSGAYDGKIKVWDLVAALDPRAASNTLCLNTLVEHTGRVFRLQFDEFQIVSSSH
DDTILIWDFLNFTPNENKTGRTPSPALMEH
NT seq 1533 nt   +upstreamnt  +downstreamnt
atgatgaaaatggagactgacaaaataatggacgaaaccaactccaatgcacaggccttc
acaaccactatgctgtacgacccggtgcgcaagaaagactcatcgcccacctaccaaacg
gagcgggaactctgctttcagtacttcacccagtggagcgagtcgggccaggtggacttt
gtggagcacctgctgtcgcgcatgtgccactatcaacacggacagatcaatgcctatctc
aagccgatgctccagcgggactttatcacattgctgccaatcaagggtctggatcacatc
gcagaaaacattttgtcgtacttggatgccgaatcgctcaaatcatccgagctggtctgc
aaggaatggctgcgcgtcatttccgagggcatgctctggaagaagctcatcgaacgcaag
gtgcgcacagattccttgtggcgcggactggccgagcggcgtaattggatgcagtacctc
ttcaagccaagaccgggccagactcaacggccacactcattccatcgcgagttgttcccc
aagataatgaatgacattgacagcatagagaacaactggcggactggccgccacatgctg
cgccgcatcaactgccggtccgagaactcgaagggtgtctattgtctgcagtacgatgac
ggcaagattgtctccggactgagggacaacaccatcaagatctgggatcgcacggatttg
cagtgcgttaagaccctaatgggccacactggatcggtgctgtgcctgcagtatgacgac
aaggtgatcatcagtggctccagcgactccaccgtccgcgtgtgggacgtcaataccggc
gagatggtcaacacccttatccaccactgcgaggcggtgctgcacttgcgctttaacaat
ggcatgatggttacctgctccaaggatcgctccatcgccgtctgggacatgacctcaccc
agcgagattacgctgcggcgcgtccttgtcggtcaccgtgccgccgtcaatgtggtggac
tttgatgagaagtacatcgtgtccgccagcggggatcgcaccatcaaggtctggtccaca
tctagctgtgaattcgtgcgcaccttgaatggccacaagcgtggcatcgcctgcctacag
tacagagatcgcctggtggtcagcggcagctcagacaattccataagactgtgggacatt
gagtgcggtgcctgtttacgtgtcctggagggccatgaggaattggttcgctgcattcgt
ttcgatacgaaacgaatcgttagcggtgcctacgatggcaagatcaaggtttgggatttg
gtcgccgccctggatccaagagcagcctccaatactctctgtctgaatacccttgtggaa
catactggtcgcgtatttcgtttgcaattcgatgagttccagattgttagcagctcgcat
gatgatacaattttgatttgggactttctaaatttcacacccaatgagaacaagaccgga
cgcacaccgtcaccggccttgatggaacattaa

DBGET integrated database retrieval system