Drosophila melanogaster (fruit fly): Dmel_CG34440 Help Entry Dmel_CG34440      CDS       T00030                                  Symbol lmgA Name (RefSeq) lemming A, isoform A   KO K03358   anaphase-promoting complex subunit 11 Organism dme  Drosophila melanogaster (fruit fly) Pathway dme04120   Ubiquitin mediated proteolysis Brite KEGG Orthology (KO) [BR:dme00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     Dmel_CG34440 (lmgA)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:dme04121]     Dmel_CG34440 (lmgA)    03036 Chromosome and associated proteins [BR:dme03036]     Dmel_CG34440 (lmgA) Ubiquitin system [BR:dme04121]  Ubiquitin ligases (E3)   Multi subunit type E3    APC/C     Ring finger protein      Dmel_CG34440 (lmgA) Chromosome and associated proteins [BR:dme03036]  Eukaryotic type   Sister chromatid separation proteins    APC/C complex     Dmel_CG34440 (lmgA) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  zf-ANAPC11 zf-rbx1 zf-RING_2 zf-C3HC4 zf-C3HC4_2 zf-RING_UBOX zf-C3HC4_3 Opy2 Motif Other DBs NCBI-GeneID:  5740853 NCBI-ProteinID:  NP_001097122 FlyBase:  FBgn0250903 UniProt:  Q7KA43 LinkDB All DBs Position 2L Genome browser AA seq 85 aa AA seqDB search MKVTIKSWTGVATWRWIANDENCGICRMSFESTCPECALPGDDCPLVWGVCSHCFHMHCI VKWLNLQPLNKQCPMCRQSWKFNVH NT seq 258 nt NT seq  +upstreamnt  +downstreamnt atgaaagtgacaatcaagtcatggacgggagttgcaacttggcgttggatagcgaatgac gagaactgcggtatctgtcgcatgtccttcgagagcacctgcccggagtgcgctctgccc ggtgacgactgcccgctggtgtggggtgtatgctctcattgcttccacatgcactgcatc gtcaagtggctgaacctgcaaccgttgaacaaacagtgccccatgtgccgccagagctgg aagttcaacgtgcattaa

DBGET integrated database retrieval system