Drosophila melanogaster (fruit fly): Dmel_CG40635 Help Entry Dmel_CG40635      CDS       T00030                                  Symbol CG40635 Name (RefSeq) uncharacterized protein   KO K03115   casein kinase II subunit beta Organism dme  Drosophila melanogaster (fruit fly) Pathway dme03008   Ribosome biogenesis in eukaryotes dme03083   Polycomb repressive complex dme04137   Mitophagy - animal dme04310   Wnt signaling pathway Brite KEGG Orthology (KO) [BR:dme00001]  09120 Genetic Information Processing   09122 Translation    03008 Ribosome biogenesis in eukaryotes     Dmel_CG40635 (CG40635)   09126 Chromosome    03083 Polycomb repressive complex     Dmel_CG40635 (CG40635)  09130 Environmental Information Processing   09132 Signal transduction    04310 Wnt signaling pathway     Dmel_CG40635 (CG40635)  09140 Cellular Processes   09141 Transport and catabolism    04137 Mitophagy - animal     Dmel_CG40635 (CG40635)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03009 Ribosome biogenesis [BR:dme03009]     Dmel_CG40635 (CG40635)    03036 Chromosome and associated proteins [BR:dme03036]     Dmel_CG40635 (CG40635) Ribosome biogenesis [BR:dme03009]  Eukaryotic type   90S particles    Kinase     Dmel_CG40635 (CG40635) Chromosome and associated proteins [BR:dme03036]  Eukaryotic type   Histone modification proteins    Polycomb repressive complex (PRC) and associated proteins     Noncanonical PRC1 (PRC1.3/1.5)      Dmel_CG40635 (CG40635) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  CK_II_beta Motif Other DBs NCBI-GeneID:  5740827 NCBI-ProteinID:  NP_001104166 FlyBase:  FBgn0085506 UniProt:  A8QIA9 LinkDB All DBs Position Y Genome browser AA seq 88 aa AA seqDB search MSSHQNNKPILDSSWISSFLGIKGNEFLCRVPIDYIQDPFNRTGLELFPQTLDVFLNLVF DRSTDWVSGDEEKLYGMIHARYIVSKRG NT seq 264 nt NT seq  +upstreamnt  +downstreamnt atgtcaagccaccagaacaataagccgatattagatagcagttggatcagttcgttcctc gggatcaagggcaacgagttcctttgccgcgtgcctatcgactacattcaggacccgttc aaccggacgggcctagagttattcccccagacactggacgtgttcctgaatctggtgttc gaccgttctacggactgggtctccggagatgaggaaaagctgtacggcatgattcacgcc cgatacatagtgtcgaagcgtggc

DBGET integrated database retrieval system