Drosophila melanogaster (fruit fly): Dmel_CG42511 Help Entry Dmel_CG42511      CDS       T00030                                  Symbol BBIP1 Name (RefSeq) BBSome interacting protein 1   KO K19399   BBSome-interacting protein 1 Organism dme  Drosophila melanogaster (fruit fly) Brite KEGG Orthology (KO) [BR:dme00001]  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    03037 Cilium and associated proteins [BR:dme03037]     Dmel_CG42511 (BBIP1) Cilium and associated proteins [BR:dme03037]  Primary cilia and associated proteins   BBSome    Dmel_CG42511 (BBIP1) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  BBIP10 GN3L_Grn1 Motif Other DBs NCBI-GeneID:  8674100 NCBI-ProteinID:  NP_001163568 FlyBase:  FBgn0260237 UniProt:  E1JIG6 LinkDB All DBs Position 3R Genome browser AA seq 76 aa AA seqDB search MSSVEAEVLQKIDLIEPTTGKLFFEHKTELLFCRPHLMPLKTQALERLEEMHRDTARQLQ KKRQQKKKSTEPTGSL NT seq 231 nt NT seq  +upstreamnt  +downstreamnt atgtcctcagtggaggccgaggtgctgcagaaaatcgatctgattgagcccacaaccgga aaattgtttttcgagcacaaaacggagctgcttttctgccggccacatctgatgccgcta aagacgcaggcgctggaacgcctggaggaaatgcatcgggacaccgctcgccaattgcag aagaagcgccagcagaagaagaagtccacggagcccacaggctcgctatga

DBGET integrated database retrieval system