Drosophila melanogaster (fruit fly): Dmel_CG43662 Help Entry Dmel_CG43662      CDS       T00030                                  Symbol Polr2D Name (RefSeq) RNA polymerase II subunit D   KO K03012   DNA-directed RNA polymerase II subunit RPB4 Organism dme  Drosophila melanogaster (fruit fly) Pathway dme03020   RNA polymerase dme03420   Nucleotide excision repair Brite KEGG Orthology (KO) [BR:dme00001]  09120 Genetic Information Processing   09121 Transcription    03020 RNA polymerase     Dmel_CG43662 (Polr2D)   09124 Replication and repair    03420 Nucleotide excision repair     Dmel_CG43662 (Polr2D)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03021 Transcription machinery [BR:dme03021]     Dmel_CG43662 (Polr2D)    03400 DNA repair and recombination proteins [BR:dme03400]     Dmel_CG43662 (Polr2D) Transcription machinery [BR:dme03021]  Eukaryotic type   RNA polymerase II system    RNA polymerase II     Pol II specific subunits      Dmel_CG43662 (Polr2D) DNA repair and recombination proteins [BR:dme03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     TCR (transcription coupled repair) factors      DNA-directed RNA polymerase II complex       Dmel_CG43662 (Polr2D) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  RNA_pol_Rpb4 AAA_5 Motif Other DBs NCBI-GeneID:  14462484 NCBI-ProteinID:  NP_001014633 FlyBase:  FBgn0263757 UniProt:  Q9VEA5 A0A1B2AK30 LinkDB All DBs Position 3R Genome browser AA seq 139 aa AA seqDB search MSFMNPVDMVDEDAADLQFPKEFENAETLLISEVHMLLDHRKRQNESADEEQEFSEVFMK TYAYTDSFRKFKNKETIMSARSLLMQKKLHKFELAALGNLCPEAPEEAKALIPSLEGRFE DEELRQILDDIGTKRSLQY NT seq 420 nt NT seq  +upstreamnt  +downstreamnt atgtcttttatgaaccccgtggatatggtggatgaggacgccgccgacctgcagtttccc aaagagttcgaaaatgccgagacgctgctgatatcggaggtgcacatgcttctcgatcac cgaaagcgacaaaacgaatccgccgacgaggagcaagagttctccgaggtcttcatgaag acgtacgcctacacggatagttttcgaaagttcaaaaacaaggagaccataatgtctgcg cgaagcttgctgatgcagaaaaagctgcacaaattcgaactggcggcactgggtaatttg tgtccggaggcgcccgaggaggccaaggcgctgattccttcactagagggtcgcttcgag gatgaggagctgcgccaaatactcgacgatatcggcactaaacgcagcttacaatactaa

DBGET integrated database retrieval system