KEGG   Drosophila melanogaster (fruit fly): Dmel_CG4889
Entry
Dmel_CG4889       CDS       T00030                                 
Symbol
wg
Name
(RefSeq) wingless
  KO
K03209  wingless-type MMTV integration site family, member 1
Organism
dme  Drosophila melanogaster (fruit fly)
Pathway
dme04150  mTOR signaling pathway
dme04310  Wnt signaling pathway
dme04391  Hippo signaling pathway - fly
Brite
KEGG Orthology (KO) [BR:dme00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    Dmel_CG4889 (wg)
   04391 Hippo signaling pathway - fly
    Dmel_CG4889 (wg)
   04150 mTOR signaling pathway
    Dmel_CG4889 (wg)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:dme00536]
    Dmel_CG4889 (wg)
Glycosaminoglycan binding proteins [BR:dme00536]
 Heparan sulfate / Heparin
  Morphogens
   Dmel_CG4889 (wg)
SSDB
Motif
Pfam: wnt
Other DBs
NCBI-GeneID: 34009
NCBI-ProteinID: NP_523502
FlyBase: FBgn0284084
UniProt: P09615 I1WYH9
LinkDB
Position
2L
AA seq 468 aa
MDISYIFVICLMALCSGGSSLSQVEGKQKSGRGRGSMWWGIAKVGEPNNITPIMYMDPAI
HSTLRRKQRRLVRDNPGVLGALVKGANLAISECQHQFRNRRWNCSTRNFSRGKNLFGKIV
DRGCRETSFIYAITSAAVTHSIARACSEGTIESCTCDYSHQSRSPQANHQAGSVAGVRDW
EWGGCSDNIGFGFKFSREFVDTGERGRNLREKMNLHNNEAGRAHVQAEMRQECKCHGMSG
SCTVKTCWMRLANFRVIGDNLKARFDGATRVQVTNSLRATNALAPVSPNAAGSNSVGSNG
LIIPQSGLVYGEEEERMLNDHMPDILLENSHPISKIHHPNMPSPNSLPQAGQRGGRNGRR
QGRKHNRYHFQLNPHNPEHKPPGSKDLVYLEPSPSFCEKNLRQGILGTHGRQCNETSLGV
DGCGLMCCGRGYRRDEVVVVERCACTFHWCCEVKCKLCRTKKVIYTCL
NT seq 1407 nt   +upstreamnt  +downstreamnt
atggatatcagctatatcttcgtcatctgcctgatggccctgtgcagcggcggcagcagt
ctcagccaagtcgagggcaaacagaaatccggaaggggccggggctccatgtggtggggc
attgccaaggtcggcgaacccaacaacattacgcccatcatgtacatggacccagcgatc
cactctacgttgagaaggaaacagcgacgcctggtcagggacaatcccggtgtactggga
gccctggtcaagggcgccaacttggccattagcgagtgccaacaccagttcagaaatcgc
cgctggaactgctcgacgagaaacttctcgaggggcaaaaatctattcggcaaaatcgtt
gatcgaggctgccgagagacgagcttcatttacgcaatcaccagcgcggcggtgacccac
tcgattgccagggcctgcagtgaaggaacgatagagtcctgcacctgcgactacagccac
cagtcgagatctccacaagcgaaccaccaggcgggcagtgtggccggcgtgcgggattgg
gagtggggcggctgctccgacaacatcggattcgggttcaagttctcccgggaattcgtc
gataccggcgagaggggtcgcaatctgcgcgagaagatgaatctgcacaacaacgaggcg
ggtcgagcgcacgtccaagcggagatgcgacaggagtgcaaatgccatggcatgtccgga
tcgtgtacagtgaagacctgctggatgcgactggccaacttccgtgtgattggcgacaat
ctgaaggcccgcttcgatggagccacccgcgtgcaagtgaccaacagtctccgggccacc
aacgctctggccccagttagtccgaatgcagccggctcgaattccgtgggctccaacggc
ctgattattccgcagtctggtctggtctacggcgaggaggaggagcgtatgctgaacgac
catatgccggacatcctgctagagaacagccacccgatcagcaagatccatcacccgaac
atgccgtcgcccaacagtttgccccaggctggtcaaaggggcggacgaaatggacgtcgt
cagggacgcaagcataatagatatcacttccaactgaacccgcacaatcccgagcacaag
ccacccggctcgaaggaccttgtctatctggagccttcgccgagcttctgcgagaagaac
ctgcggcagggcatcctgggaacccatggccgccagtgcaatgagacctcgctgggcgtc
gacggctgtgggctgatgtgctgtgggcgtggctatcggcgagacgaggtcgtcgttgtg
gagcggtgcgcctgcaccttccactggtgctgcgaggtgaagtgcaagctgtgtcggacc
aaaaaggtcatctacacgtgtctgtaa

KEGG   Drosophila melanogaster (fruit fly): Dmel_CG4969
Entry
Dmel_CG4969       CDS       T00030                                 
Symbol
Wnt6
Name
(RefSeq) Wnt oncogene analog 6, isoform C
  KO
K00445  wingless-type MMTV integration site family, member 6
Organism
dme  Drosophila melanogaster (fruit fly)
Pathway
dme04150  mTOR signaling pathway
dme04310  Wnt signaling pathway
Brite
KEGG Orthology (KO) [BR:dme00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    Dmel_CG4969 (Wnt6)
   04150 mTOR signaling pathway
    Dmel_CG4969 (Wnt6)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:dme00536]
    Dmel_CG4969 (Wnt6)
Glycosaminoglycan binding proteins [BR:dme00536]
 Heparan sulfate / Heparin
  Morphogens
   Dmel_CG4969 (Wnt6)
SSDB
Motif
Pfam: wnt
Other DBs
NCBI-GeneID: 34010
NCBI-ProteinID: NP_001260188
FlyBase: FBgn0031902
UniProt: Q9VM26
LinkDB
Position
2L
AA seq 420 aa
MRLLMVIAILIFAMPMTGFGWAEGTNILLDPNLMCKKTRRLRGKLAEICRHDSALLKEII
INGINLGFRECEFQFRNRRWNCTVLRKSMRKILMRDSRETGFVNAITAAGVTYAVTKACT
MGQLVECSCDKAHMRRNGGQPQMVTAATAEAALERQQQAAMLRQQMPLQDQHPSQRLSRM
NNASTMTDIAPVEHRGGRNRRPGGRRGRRKFWDNIKFPEGQWEWGGCSDNVNFGLRHSRV
FLDAKQRQRRSDLGTLVKFHNNNAGRLAIRDAMRLECKCHGLSGSCTVKTCWLKMPPFRE
VAGRLRDRYDSARKVTLRNDGNSFMPESPHARPANKYQLVFADDSPDFCTPNSKTGALGT
QGRECNVTSSGSDRCDRLCCNRGHTRRIVEEQTNCKCVFKWCCEVTCEKCLEHRAVNTCL
NT seq 1263 nt   +upstreamnt  +downstreamnt
atgcgtttgctcatggtaattgcaattttaatattcgcaatgccaatgactggattcggc
tgggcggagggcaccaacatccttctcgatccaaatctaatgtgcaaaaagacacgtcgt
ctgcgcggcaagttggccgaaatctgtcggcacgattcggccctgctcaaagagatcatc
atcaatggcatcaacctgggcttccgcgaatgcgagtttcaattccgcaaccgccggtgg
aactgcactgttctgcgcaagagcatgaggaaaatcttaatgcgcgattcccgagagacg
ggtttcgtgaacgcgatcacagccgcgggagtgacctacgccgtgacgaaggcctgcacg
atgggccagctggtggagtgctcctgcgacaaggcgcatatgcgcagaaacggcggccag
ccacagatggtgacggcggccaccgcagaggcggcactggagcggcagcaacaggcggcg
atgctgcgacaacaaatgccgctgcaggatcaacatcccagtcagcggctgagtcgcatg
aacaacgccagcaccatgaccgatatagctccagtggagcatagaggcgggcgaaatcgc
aggcccggcggaaggcgggggcgccgcaagttctgggacaacattaagtttcccgagggg
cagtgggagtggggcggatgcagtgacaacgttaactttggccttcgtcactcgcgcgtt
ttccttgacgccaagcaaaggcaaaggcgtagcgatctgggcacgctggttaagttccac
aataataacgcaggtcgattggccattcgcgatgccatgcggctggagtgcaagtgtcac
gggctttccggctcctgcacggtgaagacctgctggctgaagatgcctccgttccgagaa
gtggcaggacgactgcgagaccggtatgacagtgctaggaaggtgacgttgcgcaacgac
gggaacagcttcatgccggagagtccgcacgcgaggccagcgaacaagtaccagttggtc
ttcgcagacgattcgcccgacttttgcacacccaactccaagacgggagcactcggaact
cagggcagggagtgcaatgtgaccagttccggatcggatcgatgcgatcgcttgtgctgc
aatcgaggacacacccgcaggattgtggaggagcaaaccaactgcaagtgcgtctttaag
tggtgctgcgaggtgacctgcgaaaagtgcctggaacaccgggcggtcaacacctgcctc
tga

KEGG   Drosophila melanogaster (fruit fly): Dmel_CG4971
Entry
Dmel_CG4971       CDS       T00030                                 
Symbol
Wnt10
Name
(RefSeq) Wnt oncogene analog 10
  KO
K01357  wingless-type MMTV integration site family, member 10
Organism
dme  Drosophila melanogaster (fruit fly)
Pathway
dme04150  mTOR signaling pathway
dme04310  Wnt signaling pathway
Brite
KEGG Orthology (KO) [BR:dme00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    Dmel_CG4971 (Wnt10)
   04150 mTOR signaling pathway
    Dmel_CG4971 (Wnt10)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:dme00536]
    Dmel_CG4971 (Wnt10)
Glycosaminoglycan binding proteins [BR:dme00536]
 Heparan sulfate / Heparin
  Morphogens
   Dmel_CG4971 (Wnt10)
SSDB
Motif
Pfam: wnt
Other DBs
NCBI-GeneID: 34011
NCBI-ProteinID: NP_609109
FlyBase: FBgn0031903
UniProt: Q9VM25
LinkDB
Position
2L
AA seq 493 aa
MKIYANQSRTMTAWRATSKGHEQQQLPQQQKQQQEAGSSSSSNSSSNNLVATPATSRHCN
LHLIVMIILACCTRWLYGLPDGRATCRSVPGLTKDQVELCYKASDVTAAALEGLDMAIRE
CQIQFQWHRWNCSSLSTKSRNPHASSLLKKGYRESAFAFAISAAGVAHSVARACSQGRLM
SCGCDPTINRKTLNKNLRQSLDKEKKQFLQYLETNQILTPEEEKKYERSKIASRWKWGGC
SHNMDFGVEYSKLFLDCREKAGDIQSKINLHNNHAGRIAVSNNMEFRCKCHGMSGSCQLK
TCWKSAPDFHIVGKVLKHQFRKAILVDQSNLGNGEPVVVLKRARNKKSNGGSGSGSTSPD
LDSTDASGGHDDGGTGDSETRRHDELGVERGTRQPSADKNAARMARKLETSLFYYQRSPN
FCERDLGADIQGTVGRKCNRNTTTSDGCTSLCCGRGHSQVIQRRAERCHCKFQWCCNVEC
EECHVEEWISICN
NT seq 1482 nt   +upstreamnt  +downstreamnt
atgaaaatttatgcaaatcaaagccgaacgatgactgcgtggcgagcaacatcaaaaggc
cacgagcagcagcaactgccgcagcagcagaagcagcagcaagaagcaggaagcagcagc
agcagcaacagcagcagcaacaacctggttgccacaccggccacatcgcgccattgcaat
ttgcatttaattgttatgattatcttggcctgctgcacacgctggctctatggcttgccg
gatggtcgtgccacctgccgttcagtgcctggattgaccaaggatcaagtggagctctgc
tacaaggccagtgatgtgacggcggcagctctcgaaggactcgacatggccatacgagaa
tgtcaaattcagtttcaatggcatcggtggaactgttcgtcgctgagcacaaagagccgc
aatccgcatgcctccagtttgctgaagaaaggctaccgagagagtgcgttcgcctttgcc
atctcggctgccggggtggcccacagtgtggctcgcgcctgtagccaaggtcgtttgatg
tcctgcggctgcgaccccaccatcaatcgcaagacgctgaacaagaacctgcgccagtct
ctggacaaggagaagaagcagtttctgcagtacttggagaccaatcagattctaacgccc
gaggaggagaagaagtacgagcgctccaagatcgccagtcgctggaagtggggcggctgc
tcccacaacatggactttggggtcgagtactccaagctcttcctcgactgccgcgagaag
gccggcgacattcagtcgaagatcaatctgcacaacaatcacgccggccggatagccgtc
tccaacaacatggagttccggtgcaaatgccatggaatgtccggcagctgccagctgaag
acgtgctggaagtccgcgcccgattttcacattgtgggcaaggtgctgaagcaccagttc
cgcaaggccattctggtggatcaatcgaatctgggcaacggggagcccgtggtcgttttg
aaacgggcgcgcaataagaaatcgaacggtggcagcggctccggatccacgtcgcccgat
ctggacagcacggatgcatctggtggccacgatgatggagggacaggtgactctgagacg
cggcggcatgacgaactcggtgtggagcggggcacgcggcaaccgagcgccgataagaat
gcggcacgaatggcccgaaaactggagacatcgctgttctactatcagcgctcgcccaac
ttttgtgagcgcgatctgggagctgatatacagggcaccgtgggacgcaagtgcaatcgg
aacaccacgaccagcgacggatgcacctccctctgctgtggccgtggccacagccaggtc
atccagcggagggcggagcggtgtcactgtaaattccaatggtgctgtaatgtggagtgc
gaggagtgccacgtagaggaatggattagcatatgcaattaa

KEGG   Drosophila melanogaster (fruit fly): Dmel_CG6407
Entry
Dmel_CG6407       CDS       T00030                                 
Symbol
Wnt5
Name
(RefSeq) Wnt oncogene analog 5, isoform B
  KO
K00444  wingless-type MMTV integration site family, member 5
Organism
dme  Drosophila melanogaster (fruit fly)
Pathway
dme04150  mTOR signaling pathway
dme04310  Wnt signaling pathway
Brite
KEGG Orthology (KO) [BR:dme00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    Dmel_CG6407 (Wnt5)
   04150 mTOR signaling pathway
    Dmel_CG6407 (Wnt5)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:dme00536]
    Dmel_CG6407 (Wnt5)
Glycosaminoglycan binding proteins [BR:dme00536]
 Heparan sulfate / Heparin
  Morphogens
   Dmel_CG6407 (Wnt5)
SSDB
Motif
Pfam: wnt
Other DBs
NCBI-GeneID: 32838
NCBI-ProteinID: NP_001285407
FlyBase: FBgn0010194
UniProt: P28466 X2JL29
LinkDB
Position
X:complement(18501401..18505405)
AA seq 1004 aa
MSCYRKRHFLLWLLRAVCMLHLTARGAYATVGLQGVPTWIYLGLKSPFIEFGNQVEQLAN
SSIPLNMTKDEQANMHQEGLRKLGTFIKPVDLRDSETGFVKADLTKRLVFDRPNNITSRP
IHPIQEEMDQKQIILLDEDTDENGLPASLTDEDRKFIVPMALKNISPDPRWAATTPSPSA
LQPNAKAISTIVPSPLAQVEGDPTSNIDDLKKHILFLHNMTKTNSNFESKFVKFPSLQKD
KAKTSGAGGSPPNPKRPQRPIHQYSAPIAPPTPKVPAPDGGGVGGAAYNPGEQPIGGYYQ
NEELANNQSLLKPTDTDSHPAAGGSSHGQKNPSEPQVILLNETLSTETSIEADRSPSINQ
PKAGSPARTTKRPPCLRNPESPKCIRQRRREEQQRQRERDEWFRGQSQYMQPRFEPIIQT
INNTKRFAVSIEIPDSFKVSSEGSDGELLSRVERSQPSISSSSSSSSSSSRKIMPDYIKV
SMENNTSVTDYFKHDVVMTSADVASDREFLIKNMEEHGGAGSANSHHNDTTPTADAYSET
IDLNPNNCYSAIGLSNSQKKQCVKHTSVMPAISRGARAAIQECQFQFKNRRWNCSTTNDE
TVFGPMTSLAAPEMAFIHALAAATVTSFIARACRDGQLASCSCSRGSRPKQLHDDWKWGG
CGDNLEFAYKFATDFIDSREKETNRETRGVKRKREEINKNRMHSDDTNAFNIGIKRNKNV
DAKNDTSLVVRNVRKSTEAENSHILNENFDQHLLELEQRITKEILTSKIDEEEMIKLQEK
IKQEIVNTKFFKGEQQPRKKKRKNQRAAADAPAYPRNGIKESYKDGGILPRSTATVKARS
LMNLHNNEAGRRAVIKKARITCKCHGVSGSCSLITCWQQLSSIREIGDYLREKYEGATKV
KINKRGRLQIKDLQFKVPTAHDLIYLDESPDWCRNSYALHWPGTHGRVCHKNSSGLESCA
ILCCGRGYNTKNIIVNERCNCKFHWCCQVKCEVCTKVLEEHTCK
NT seq 3015 nt   +upstreamnt  +downstreamnt
atgagttgctacagaaaaaggcactttctattgtggctcttgcgtgctgtgtgtatgttg
cacttaaccgcgagaggggcatatgccacagttgggttgcaaggagtgccgacatggata
tatctcggcctcaagtcccccttcatcgagtttggcaaccaggtggagcagctggccaat
tccagcataccactgaacatgaccaaggacgagcaggccaatatgcatcaagagggccta
cgcaagctcggtacgttcataaagccagtggacctgcgggactcggagactggcttcgtc
aaggccgatctcaccaagagactggtattcgatagaccgaacaacattacatctcgccct
attcacccgatacaggaggagatggatcagaagcagataatcctgctcgacgaggatacc
gacgagaatggcctgccagccagtctcaccgacgaggatcgcaagtttatagtgccgatg
gcgctcaagaatatatcgcccgatccacgctgggcggccactacaccgagtccctccgct
ttgcagccgaacgctaaagccatctcgaccattgtgccctcgcctctggcccaggtcgag
ggggatcccacgtccaacatcgatgacctgaagaagcacatactcttcttgcacaacatg
accaagaccaattcgaacttcgagtcgaaattcgttaaattcccgagcctgcaaaaggac
aaggccaagacatcgggagctggcggttcgccgcccaatcccaagcggccccagcggccg
attcatcagtattccgcgcccatagccccaccaacacccaaggtgcccgcgccagatggc
ggcggcgtaggaggagcagcttacaatcccggagagcagccaattggtggctactatcag
aacgaggaactagcgaataatcaatcccttcttaaaccaacagataccgactcccatcca
gcggccggcggtagcagccatggccagaagaatcccagcgagccccaggtgatactgctc
aacgagacactctccacggagacctcaatcgaagcggatcgcagtccatcgataaaccag
cccaaggcgggatcgcctgcgcgcacaacaaagcgaccaccttgcctgcgcaatcccgag
tccccgaaatgcatacgtcagcgtcggcgggaggagcaacagcggcagcgggagcgggac
gagtggttccgcggtcagtcgcagtacatgcagccccggttcgagccgatcatacagacg
attaacaatacgaagagatttgccgtatcaatcgagattccagactcctttaaagtatcc
tccgagggatcggatggggagttgctttcgcgagtcgaacgctcgcagcccagcattagt
agtagtagtagtagcagtagtagcagtagtaggaaaatcatgccagactatattaaggta
tccatggagaacaacacatccgtcacggattattttaagcacgacgttgtgatgacatcg
gcagatgtcgccagcgatagggaattccttatcaagaacatggaggagcacggaggcgct
ggctccgcgaacagtcatcacaatgatacgactccaactgcagacgcatattcggagaca
atcgatcttaatcccaataactgctatagcgcaataggtctaagcaacagccaaaagaag
caatgtgttaagcacaccagcgtgatgccggccataagtcgtggtgcccgtgccgccatc
caggagtgccagtttcagttcaagaatcgccgctggaactgcagcacaacgaacgacgag
accgtatttggtcccatgaccagcctggctgctcccgaaatggccttcatccacgccctg
gccgcggccacggtgaccagcttcatagctcgcgcctgccgggatggccaactggcctcc
tgcagctgctcccgcggcagtcgacccaaacagctccacgacgactggaagtggggcggc
tgtggcgacaacctggagttcgcctacaagttcgccacggacttcatcgattcgcgggag
aaggaaaccaatcgcgagacgcgtggcgttaagagaaaacgcgaggagatcaacaagaat
cgcatgcattccgatgacacgaatgcttttaacataggtattaaacgtaacaaaaacgta
gatgctaaaaacgatacaagtttggtagtgagaaacgttaggaaaagcactgaggctgaa
aacagtcacatactcaatgagaactttgatcagcacctattggaactagagcagcgcatt
acgaaggagatacttacatccaagatagacgaggaggagatgattaagctgcaggagaag
atcaaacaggagattgtcaacaccaagttcttcaagggtgagcagcagccgcgcaagaag
aagcgaaaaaaccagagagccgccgccgatgcgcccgcctatccgaggaacggcatcaag
gagagctacaaggatggcggcatattgccgcgcagcacggccactgtcaaggccaggagc
ctgatgaacttgcacaacaacgaggccggacgtcgggcggtgatcaagaaggccaggata
acgtgcaagtgccacggcgtgtccggctcctgcagcctgatcacctgctggcagcaattg
tcctccatccgggagattggcgactatctgcgcgagaagtacgagggcgccaccaaggtg
aagatcaacaagcgtggccgcctccagatcaaggacttgcaattcaaggtgccgaccgct
cacgatcttatttacctagacgaaagtcccgactggtgccgcaatagctatgcgctgcat
tggccgggaacgcacggacgtgtgtgccacaaaaactcgtcgggattggagagctgtgcc
atcctctgctgcggccggggctataatacgaagaacattatagttaacgaacgctgcaat
tgcaaatttcactggtgttgccaggttaaatgtgaagtttgtacgaaggtactcgaggag
cacacatgtaaatag

KEGG   Drosophila melanogaster (fruit fly): Dmel_CG8458
Entry
Dmel_CG8458       CDS       T00030                                 
Symbol
wntD
Name
(RefSeq) wnt inhibitor of dorsal
  KO
K00714  wingless-type MMTV integration site family, member 8
Organism
dme  Drosophila melanogaster (fruit fly)
Pathway
dme04150  mTOR signaling pathway
dme04310  Wnt signaling pathway
Brite
KEGG Orthology (KO) [BR:dme00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    Dmel_CG8458 (wntD)
   04150 mTOR signaling pathway
    Dmel_CG8458 (wntD)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:dme00536]
    Dmel_CG8458 (wntD)
Glycosaminoglycan binding proteins [BR:dme00536]
 Heparan sulfate / Heparin
  Morphogens
   Dmel_CG8458 (wntD)
SSDB
Motif
Pfam: wnt
Other DBs
NCBI-GeneID: 41633
NCBI-ProteinID: NP_650272
FlyBase: FBgn0038134
UniProt: Q9VFX1
Structure
LinkDB
Position
3R
AA seq 309 aa
MIFAITFFMGITSTLAAVLEPMSYYQYTQFQAPLSWEDITGKGLKQALDSCQQSFQWQRW
NCPSQDFVQKNSKPEENSPNREDVYVAAISMAAIVHTLTKDCANGVIAGCGCTENALNVP
CAHEPTKALEQYEKHFGSGSGAIGHNRRVVGALLQRSLEQECRCKQPGAVQGECQEEECV
AVLKPFEAIAQDLLQMYDDAIQLEGASSNLKIMWQNIPLDSLVFMQDSPNYCERDATGLW
KGTRGRQCSKDGSGSLEERLSCQQLCRVCGYRVRSQHVRTERRCNCKLVWGFRLQCDVCV
QLERQYSCY
NT seq 930 nt   +upstreamnt  +downstreamnt
atgatttttgccatcacattcttcatgggtattacgagcactctggcagcagttttggag
cccatgagctactaccagtacacccagttccaggcaccactctcctgggaggatataacc
ggcaaggggctgaaacaggccctcgacagctgccaacagagtttccagtggcagcgatgg
aactgtccgagccaggatttcgtgcagaagaattccaagccggaggaaaactcaccaaat
cgggaggatgtctatgtggcggccatttccatggcagccatagtccatactctgaccaag
gactgtgccaatggagtaatcgccggatgcggatgcacggaaaatgctctgaatgtaccc
tgtgcccacgaacccaccaaggcactggagcagtacgagaagcatttcggatcgggatca
ggagccatcggtcacaatcgacgggtggtgggagctctactacaaagatcactggaacag
gaatgccggtgcaagcaaccaggagctgtgcagggtgaatgccaggaggaggagtgtgtg
gcggtactaaagccattcgaagccattgcccaggatctcctccaaatgtacgacgatgcc
atccaactagaaggagccagtagcaatctaaagattatgtggcagaacattcccctagac
tcgctggtcttcatgcaggactcgcccaactactgcgaacgcgatgccaccggattgtgg
aaaggaacacggggtcgccagtgctccaaggatggcagtggttctctggaggaacgcctc
tcctgccagcagttgtgccgcgtgtgcggataccgagtgagatcccagcacgtgagaacc
gagaggaggtgcaattgcaagctggtctggggattccgactccagtgcgatgtgtgcgtc
cagctggaaaggcagtactcctgctactaa

DBGET integrated database retrieval system