KEGG   Drosophila melanogaster (fruit fly): Dmel_CG4943
Entry
Dmel_CG4943       CDS       T00030                                 

Gene name
Smurf
Definition
(RefSeq) SMAD specific E3 ubiquitin protein ligase, isoform B
  KO
K04678  E3 ubiquitin ligase SMURF1/2 [EC:2.3.2.26]
Organism
dme  Drosophila melanogaster (fruit fly)
Pathway
dme04120  Ubiquitin mediated proteolysis
dme04144  Endocytosis
dme04341  Hedgehog signaling pathway - fly
dme04350  TGF-beta signaling pathway
Brite
KEGG Orthology (KO) [BR:dme00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    Dmel_CG4943 (Smurf)
 09130 Environmental Information Processing
  09132 Signal transduction
   04341 Hedgehog signaling pathway - fly
    Dmel_CG4943 (Smurf)
   04350 TGF-beta signaling pathway
    Dmel_CG4943 (Smurf)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    Dmel_CG4943 (Smurf)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:dme04131]
    Dmel_CG4943 (Smurf)
   04121 Ubiquitin system [BR:dme04121]
    Dmel_CG4943 (Smurf)
   03029 Mitochondrial biogenesis [BR:dme03029]
    Dmel_CG4943 (Smurf)
Enzymes [BR:dme01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.26  HECT-type E3 ubiquitin transferase
     Dmel_CG4943 (Smurf)
Membrane trafficking [BR:dme04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Ubiquitin E3 ligases
    Dmel_CG4943 (Smurf)
 Autophagy
  Mitophagy
   Other mitophagy associated  proteins
    Dmel_CG4943 (Smurf)
Ubiquitin system [BR:dme04121]
 Ubiquitin ligases (E3)
  HECT type E3
   Dmel_CG4943 (Smurf)
Mitochondrial biogenesis [BR:dme03029]
 Mitochondrial quality control factors
  Mitophagy factors
   Parkin-independent mechanism factors
    Dmel_CG4943 (Smurf)
SSDB
Motif
Pfam: HECT WW C2
Other DBs
NCBI-GeneID: 36999
NCBI-ProteinID: NP_001261061
FlyBase: FBgn0029006
UniProt: Q9V853 A0A0B4KFU5
LinkDB
Position
2R
AA seq 1061 aa
MNKLDYPRRNGTHKVRITILCARNLARKDLFRLPDPFAKVQVDGTGQVYSTEISKSSLDP
KWNAHYDLFLGIGDAITITVWNQRKIHKGSGFLGCVRIPAFNIQSLKGAGFQRLDLGKLS
PDDDELVRGQIIISLLSKDGPSSGNPLAIVGPSGDVRGPSEDDSSEDSLPEGWEERRTDN
GRVYYVNHATKSTQWDRPRQPGVVGSSHATSPQQRHNTHNGNSGDRQAPAGPTRSTTCTN
LMNNGHRSRDLSVTASDERRHSTEILSSVGKENTSPTTPVSATTTPGKKTSSSNSSSAGG
RTLEQRPTNEPATPTSSTTSASVRLHSNDNHVKTPKHQTNGHAPPESTPTSPTGQQNYVN
GNAQNGSTSGNGSGQAAQPQSASNGWTQEDAATTTSPSTTTSPPRHSQSPPTPNISPPAS
VTPSANGNVHSPNANSTPAGSGGGSRSYTAATPGQRSQRRSSRQQGEESSTRRRSSRGTR
NGGTSGGGGGGGSGQRYASAAIAAANQAARPFLDLPPGYEMRTTQQGQVYFYHIPTGVST
WHDPRIPRDFDTQHLTLDAIGPLPSGWEQRKTASGRVYFVDHNNRTTQFTDPRLSGSILQ
MIRRGTVPPTSAANAGTPAPPSATPATPSAAAAVPPQATPASNATPTTLTTTTNPPHRIV
PDLPQGLLEGADLLPKYRRDLVGKLRALRTELQTMQPQSGHCRLEVSRNEIFEESYRLIM
KMRAKDMRKRLMVKFKGEEGLDYGGVAREWLHLLSREMLNPQYGLFQYSRDDHYTLQINP
DSGVNPDHLSYFHFVGRTLGIAVFHGHCLDGGFTTPFYKQLLNKPITLGDIEGVDPDLHR
SLTWMLESNISGIIESTFSVENNSFGALVVHELKPGGASIPVTEENKREYVKLYVNYRFM
RGIEQQFLALQKGFCELIPSHLLRPFDERELELVIGGISSIDVNDWRNNTRLKHCTNETT
QVLWFWQVVESYSSEMRARLLQFVTGSSRVPLQGFRALQGSTGAVGPRLFTIHLTADVPT
QNLPKAHTCFNRIDLPPYETYQLLCDKLTQAVEETCGFAVE
NT seq 3186 nt   +upstreamnt  +downstreamnt
atgaataaattggattacccacgtcgcaatggtacacacaaagttcgaataacgatattg
tgtgctagaaacttggcccgcaaggatttatttcgtctacccgatccctttgctaaggtg
caggtggatggaactgggcaggtgtactcgacggaaataagcaaatcctctctggatcca
aaatggaatgcacattacgatttgtttttgggcattggggatgccattacgataactgtg
tggaatcagcgaaagatacacaagggcagtggattcctgggctgtgtgaggataccggcg
ttcaacatacagagcctcaaaggagctgggtttcaacgcttggatctgggaaaactgtcg
ccggatgacgatgagcttgtacgtggtcaaatcatcatttcgttgctctcgaaggacggt
cctagtagtggtaatcctctggccattgtaggacccagtggtgatgtccgtggaccgtcg
gaagatgactcctcggaagatagtttgccagagggttgggaggagcggcgtacggacaac
ggtcgagtttactatgtgaaccatgccaccaaatcgacgcagtgggatcgaccaagacag
ccaggagtagttggatccagtcacgccacttcaccacagcaacggcacaacacgcacaat
ggcaacagcggtgatcgacaagctccggctgggccaacccgctctacaacttgcacgaac
ctgatgaataacggtcatcgcagccgggacttgtctgtgacggcttcagatgaacgtaga
cactctacggaaatcctgtccagcgtgggcaaggagaacaccagccccacaacgcccgtt
tcggccacgacaacgcctggcaaaaaaacatcctcatcgaactcatcctcggcaggtggt
cgcactttggagcagcgtccgacaaacgaaccagcaacacccaccagcagtacgacatcg
gcgtcggttcgcctgcatagcaacgacaatcatgtaaaaacaccaaagcaccaaacgaat
ggccatgctccgccagagtccacgcccacatcccccacgggtcagcagaactatgtaaat
ggaaatgctcagaatggaagtaccagcggaaatggaagtggccaggcggcgcagccccag
agtgctagtaacggatggacgcaagaagatgccgcaacgactacttcaccttcaaccaca
acctctcctcccaggcatagtcaaagtccgccaactccaaatatatcgccgccagcttca
gtgacaccctctgcaaatggaaatgtgcacagtccgaatgcgaacagcacaccagccgga
agcggaggaggaagtagatcctatacagcagcaacgcccggtcaacgctctcagcgtcgg
agctcgcggcaacaaggtgaggagtcctccaccagacgacggtcttcacggggaacaaga
aatgggggcacatctggcggcggaggtggaggtggatctgggcagaggtacgcctcggca
gccattgcagctgccaatcaggcagcacgaccatttttggatctgccgcccggctatgaa
atgcgaacaacgcaacaagggcaggtatacttttatcacatacccactggtgtatccacg
tggcatgatcctcggatacccagagatttcgacacccaacatctaacgcttgacgctatc
ggaccattgccgagtggttgggaacagcgaaagacggcctccggaagggtttactttgtg
gaccacaacaaccgaaccacacagtttacggatccccggctaagtggcagtattttgcaa
atgattcgacgtggaaccgtaccaccaacatccgctgcaaatgctggaacaccagctccg
ccatcggctactcctgctaccccctcggccgcagcagcagttccaccacaggcgacgccg
gcgagcaacgcaactccaacgacgcttacaactacaacaaacccgccccatcgtattgtt
ccggatctgccacagggattgcttgaaggcgccgaccttttgcccaagtaccgccgcgat
ttggttggcaagctgcgggctctgcgcacggagctgcaaacgatgcagccgcaatccggc
cactgccgtttggaggtgtcacgcaacgagattttcgaggagagctatagactgataatg
aaaatgcgggccaaggacatgcgaaagcgtctaatggttaaatttaagggcgaggagggc
ctggactatggtggcgtagcacgcgagtggttgcatctgctttcccgagagatgttgaat
ccgcagtatggcctattccagtacagtagggatgatcactacacgctgcaaattaatcca
gactccggtgtgaatcccgatcacttgtcctattttcatttcgtgggtcgcacactaggg
attgccgtgttccacggtcactgtctggatggtgggttcactacacccttctacaagcag
ctgctgaacaagccgattacgcttggtgatattgaaggcgtggatccggacctacatcgc
agcctcacctggatgctggaaagcaacatcagcggcatcattgaatccacattcagtgta
gagaacaatagctttggtgctctggtggtgcatgaactgaagcctggcggtgcctccatt
ccagtgacggaggagaacaaacgcgagtatgtcaagctctatgtgaactatcgttttatg
cgcggcattgaacaacaatttttggctctgcagaaaggtttttgtgagcttatacccagc
catctcctaagaccgtttgatgagcgcgaattggaattggtcattggtggcatctctagc
atagatgtcaacgactggcggaacaatacgagactgaagcactgtacgaacgaaacgacg
caggtgttgtggttctggcaggtggtcgagtcctatagttctgagatgagagcccgtctg
ctgcaattcgtgacaggatcatcgcgagtgccgctgcagggcttcagagcgctacagggc
tccacgggagcggtgggaccacggctgtttactattcacctgactgccgacgtgcccacg
cagaacctgcccaaggcgcacacctgctttaaccggatcgatttgccgccctacgagacg
taccagctactttgcgacaagctgacgcaggccgttgaggagacctgtggatttgccgtg
gagtaa

DBGET integrated database retrieval system