Drosophila melanogaster (fruit fly): Dmel_CG5271 Help Entry Dmel_CG5271       CDS       T00030                                  Symbol RpS27A Name (RefSeq) ribosomal protein S27A   KO K02977   ubiquitin-small subunit ribosomal protein S27Ae Organism dme  Drosophila melanogaster (fruit fly) Pathway dme03010   Ribosome dme04120   Ubiquitin mediated proteolysis dme04137   Mitophagy - animal dme04140   Autophagy - animal Brite KEGG Orthology (KO) [BR:dme00001]  09120 Genetic Information Processing   09122 Translation    03010 Ribosome     Dmel_CG5271 (RpS27A)   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     Dmel_CG5271 (RpS27A)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     Dmel_CG5271 (RpS27A)    04137 Mitophagy - animal     Dmel_CG5271 (RpS27A)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03011 Ribosome [BR:dme03011]     Dmel_CG5271 (RpS27A)    04121 Ubiquitin system [BR:dme04121]     Dmel_CG5271 (RpS27A)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:dme04147]     Dmel_CG5271 (RpS27A) Ribosome [BR:dme03011]  Ribosomal proteins   Eukaryotes    Small subunit     Dmel_CG5271 (RpS27A)   Archaea     Dmel_CG5271 (RpS27A) Ubiquitin system [BR:dme04121]  Ubiquitins and ubiquitin-like proteins   Ubiquitins    Dmel_CG5271 (RpS27A) Exosome [BR:dme04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    Dmel_CG5271 (RpS27A)   Exosomal proteins of colorectal cancer cells    Dmel_CG5271 (RpS27A) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ubiquitin Ribosomal_S27 Rad60-SLD Ubiquitin_2 Rad60-SLD_2 DUF2604 IBR Dsc3_N Ubiquitin_5 TBK1_ULD OTU1_UBXL Motif Other DBs NCBI-GeneID:  34420 NCBI-ProteinID:  NP_476778 FlyBase:  FBgn0003942 UniProt:  P15357 Q8IGR0 Structure PDBPDBj LinkDB All DBs Position 2L Genome browser AA seq 156 aa AA seqDB search MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN IQKESTLHLVLRLRGGAKKRKKKNYSTPKKIKHKRKKVKLAVLKYYKVDENGKIHRLRRE CPGENCGAGVFMAAHEDRHYCGKCNLTFVFSKPEEK NT seq 471 nt NT seq  +upstreamnt  +downstreamnt atgcagatcttcgttaagaccctcacgggcaagaccatcactcttgaggtcgaaccgtcg gatactatcgaaaatgtcaaagccaagattcaggacaaagaaggaattcctccagatcag cagcgtctgatcttcgctggcaagcagctggaagatggccgcaccctctctgactataac attcagaaggagtccactttgcacttggtgctccgcctgcgtggtggtgccaagaagcgc aagaagaagaactactccactcccaagaaaatcaagcacaagaggaagaaggtcaagcta gctgtcctgaaatactacaaggttgacgagaacggcaagatccaccgtctccgtcgcgag tgccctggtgagaactgcggcgccggcgtcttcatggctgcccacgaagatcgtcactac tgcggcaagtgcaacctgacctttgtcttcagcaaaccagaggaaaagtaa

DBGET integrated database retrieval system