Drosophila melanogaster (fruit fly): Dmel_CG5588 Help Entry Dmel_CG5588       CDS       T00030                                  Symbol Mtl Name (RefSeq) Mig-2-like, isoform B   KO K04392   Ras-related C3 botulinum toxin substrate 1 Organism dme  Drosophila melanogaster (fruit fly) Pathway dme04013   MAPK signaling pathway - fly dme04145   Phagosome dme04148   Efferocytosis dme04310   Wnt signaling pathway dme04620   Toll-like receptor signaling pathway dme05100   Bacterial invasion of epithelial cells Brite KEGG Orthology (KO) [BR:dme00001]  09130 Environmental Information Processing   09132 Signal transduction    04013 MAPK signaling pathway - fly     Dmel_CG5588 (Mtl)    04310 Wnt signaling pathway     Dmel_CG5588 (Mtl)  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     Dmel_CG5588 (Mtl)    04148 Efferocytosis     Dmel_CG5588 (Mtl)  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     Dmel_CG5588 (Mtl)  09160 Human Diseases   09171 Infectious disease: bacterial    05100 Bacterial invasion of epithelial cells     Dmel_CG5588 (Mtl)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:dme04131]     Dmel_CG5588 (Mtl)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:dme04147]     Dmel_CG5588 (Mtl)    04031 GTP-binding proteins [BR:dme04031]     Dmel_CG5588 (Mtl) Membrane trafficking [BR:dme04131]  Exocytosis   Small GTPases and associated proteins    Rho GTPases     Dmel_CG5588 (Mtl)  Endocytosis   Lipid raft mediated endocytosis    Arf6-dependent endocytosis     Dmel_CG5588 (Mtl)   Macropinocytosis    Ras GTPases     Dmel_CG5588 (Mtl)  Others   NADPH oxidases (Nox) and associated proteins    Nox associated proteins     Dmel_CG5588 (Mtl) Exosome [BR:dme04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    Dmel_CG5588 (Mtl)   Exosomal proteins of other body fluids (saliva and urine)    Dmel_CG5588 (Mtl)   Exosomal proteins of colorectal cancer cells    Dmel_CG5588 (Mtl)   Exosomal proteins of bladder cancer cells    Dmel_CG5588 (Mtl) GTP-binding proteins [BR:dme04031]  Small (monomeric) G-proteins   Rho Family    Rac/Cdc42 [OT]     Dmel_CG5588 (Mtl) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU Motif Other DBs NCBI-GeneID:  43319 NCBI-ProteinID:  NP_524533 FlyBase:  FBgn0039532 UniProt:  Q7JWS8 LinkDB All DBs Position 3R Genome browser AA seq 195 aa AA seqDB search MSTGRPIKCVVVGDGTVGKTCMLISYTTDCFPGEYVPTVFDNYSAPMQVDTIQVSLGLWD TAGQEDYDRLRPLSYPQTDVFLICYSVASPSSFENVTSKWYPEIKHHCPDAPIILVGTKI DLREDRETLSGLAEQGLTPLKREQGQKLANKIRAVKYMECSALTQRGLKPVFEEAVRAVL RPEPLKRRQRKCLIM NT seq 588 nt NT seq  +upstreamnt  +downstreamnt atgtcaaccggaaggcccataaagtgtgtagtcgttggtgacggcaccgtcggaaagacc tgcatgctaatctcctacacgacagactgctttcccggcgaatatgtgcccacagtcttc gacaactactcggcgcccatgcaagtggacacaatacaggtctcgctgggactgtgggat acggcgggtcaggaggactacgaccgcctgagaccgctatcctacccgcagacagacgtt ttcctgatatgctacagcgtggcgagtccctcgtcctttgagaacgtcacctcgaaatgg tatccggagataaagcaccactgtcccgatgcgcccatcattctagttggcaccaaaatc gatttgcgcgaagatcgagagacactcagcggcctggcagagcagggactgacgccgctg aagcgcgagcagggccagaagctggcaaacaagatacgcgctgtgaaatacatggagtgc tccgccttgacgcagcgcggtctcaagccggtgttcgaggaagcggtgcgcgcggtgctc agaccagagccgctaaagcgacgccagcgaaagtgtttaataatgtaa

DBGET integrated database retrieval system