KEGG   Drosophila melanogaster (fruit fly): Dmel_CG6383
Entry
Dmel_CG6383       CDS       T00030                                 

Gene name
crb
Definition
(RefSeq) crumbs, isoform A
  KO
K16681  protein crumbs
Organism
dme  Drosophila melanogaster (fruit fly)
Pathway
dme04391  Hippo signaling pathway - fly
Brite
KEGG Orthology (KO) [BR:dme00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04391 Hippo signaling pathway - fly
    Dmel_CG6383 (crb)
SSDB
Motif
Pfam: EGF Laminin_G_1 hEGF Laminin_G_2 EGF_2 EGF_CA EGF_3 SKG6
Other DBs
NCBI-GeneID: 42896
NCBI-ProteinID: NP_524480
FlyBase: FBgn0259685
UniProt: P10040
LinkDB
Structure
PDB: 
4YL8 4WSI

Position
3R
AA seq 2146 aa
MAKIANASLSQQQKQRQAETATTTTTTVAASVETATTTARSRDRTKSAAQITSHLLKRAI
SVYSSPQWIPLFILIYLATDVASVAVPTKEAYFNGSTYLRLTTPMPIWDHSAISFRSCRG
GEILAQQYNKNSIVISVLNDFLQISLAGPAVHGPNNRLDVKLPYQLLDNRWHTLQFKYEY
GNLYLHVDRAASIFANSTYNSQFLTNQDIGYKDAILILGNSFSGCLLDGPGLQFVNNSTV
QNVVFGHCPLTPGPCSDHDLFTRLPDNFCLNDPCMGHGTCSSSPEGYECRCTARYSGKNC
QKDNGSPCAKNPCENGGSCLENSRGDYQCFCDPNHSGQHCETEVNIHPLCQTNPCLNNGA
CVVIGGSGALTCECPKGYAGARCEVDTDECASQPCQNNGSCIDRINGFSCDCSGTGYTGA
FCQTNVDECDKNPCLNGGRCFDTYGWYTCQCLDGWGGEICDRPMTCQTQQCLNGGTCLDK
PIGFQCLCPPEYTGELCQIAPSCAQQCPIDSECVGGKCVCKPGSSGYNCQTSTGDGASAL
ALTPINCNATNGKCLNGGTCSMNGTHCYCAVGYSGDRCEKAENCSPLNCQEPMVCVQNQC
LCPENKVCNQCATQPCQNGGECVDLPNGDYECKCTRGWTGRTCGNDVDECTLHPKICGNG
ICKNEKGSYKCYCTPGFTGVHCDSDVDECLSFPCLNGATCHNKINAYECVCQPGYEGENC
EVDIDECGSNPCSNGSTCIDRINNFTCNCIPGMTGRICDIDIDDCVGDPCLNGGQCIDQL
GGFRCDCSGTGYEGENCELNIDECLSNPCTNGAKCLDRVKDYFCDCHNGYKGKNCEQDIN
ECESNPCQYNGNCLERSNITLYQMSRITDLPKVFSQPFSFENASGYECVCVPGIIGKNCE
ININECDSNPCSKHGNCNDGIGTYTCECEPGFEGTHCEINIDECDRYNPCQRGTCYDQID
DYDCDCDANYGGKNCSVLLKGCDQNPCLNGGACLPYLINEVTHLYNCTCENGFQGDKCEK
TTTLSMVATSLISVTTEREEGYDINLQFRTTLPNGVLAFGTTGEKNEPVSYILELINGRL
NLHSSLLNKWEGVFIGSKLNDSNWHKVFVAINTSHLVLSANDEQAIFPVGSYETANNSQP
SFPRTYLGGTIPNLKSYLRHLTHQPSAFVGCMQDIMVNGKWIFPDEQDANISYTKLENVQ
SGCPRTEQCKPNPCHSNGECTDLWHTFACHCPRPFFGHTCQHNMTAATFGHENTTHSAVI
VETTDVARRAIRSILDISMFIRTREPTGQVFYLGTDPRKAPTKNIGDSYVAAKLHGGELL
VKMQFSGTPEAYTVGGQKLDNGYNHLIEVVRNQTLVQVKLNGTEYFRKTLSTTGLLDAQV
LYLGGPAPTRESLLGATTEPGIIPVPGAGIPIEDTTVPKEADDSRDYFKGIIQDVKVSNG
SLNLIVEMYSLNVTDVQVNAKPLGAVTIDRASVLPGEVSDDLCRKNPCLHNAECRNTWND
YTCKCPNGYKGKNCQEIEFCQHVTCPGQSLCQNLDDGYECVTNTTFTGQERSPLAFFYFQ
EQQSDDIVSEASPKQTLKPVIDIAFRTRAGGTLLYIDNVDGFFEIGVNGGRVTITWKLSA
LHFGESARFEKENTDGEWSRIYLRAHNSKLEGGWKGWESMVDPTPAFSTDIDQAAFQSLI
ATSTQVYLGGMPESRQARGSTLSAQQGSQFKGCVGEARVGDLLLPYFSMAELYSRTNVSV
QQKAQFRLNATRPEEGCILCFQSDCKNDGFCQSPSDEYACTCQPGFEGDDCGTDIDECLN
TECLNNGTCINQVAAFFCQCQPGFEGQHCEQNIDECADQPCHNGGNCTDLIASYVCDCPE
DYMGPQCDVLKQMTCENEPCRNGSTCQNGFNASTGNNFTCTCVPGFEGPLCDIPFCEITP
CDNGGLCLTTGAVPMCKCSLGYTGRLCEQDINECESNPCQNGGQCKDLVGRYECDCQGTG
FEGIRCENDIDECNMEGDYCGGLGRCFNKPGSFQCICQKPYCGAYCNFTDPCNATDLCSN
GGRCVESCGAKPDYYCECPEGFAGKNCTAPITAKEDGPSTTDIAIIVIPVVVVLLLIAGA
LLGTFLVMARNKRATRGTYSPSAQEYCNPRLEMDNVLKPPPEERLI
NT seq 6441 nt   +upstreamnt  +downstreamnt
atggctaaaatcgccaatgcgtcactgtcgcaacaacaaaaacagcggcaagcagaaaca
gcaacgaccacaacaacaacagtggcggcatcagtagaaacagcaacaacaacagcaaga
agtcgagaccgcacgaaaagcgcagctcaaattacgtcgcatttgctcaagcgcgccatt
tcagtttattcgtcgcctcaatggataccgctcttcatacttatttacttagcaacagat
gtcgcctcagtggcggtgccgacgaaggaggcgtactttaatggctccacttacctccgc
ctcaccacgccgatgcccatttgggatcactcggcgattagtttccgctcgtgccgcggc
ggcgagatcctcgcccagcagtacaacaagaactccattgtaatctcagtgctcaatgac
tttctgcaaatctcactggctggacccgccgtccatgggcccaacaaccggctggatgtc
aagctgccctaccaactgctggacaaccgctggcatacgctgcagttcaagtacgagtac
ggaaatctctacctgcatgtggatcgcgcggcaagcatatttgccaactccacgtacaac
agtcagttcctgactaaccaggacattggctacaaggacgccatcttgatactgggaaac
tccttctccggttgccttctggatggaccaggtctgcaatttgtgaacaactcgacggtg
cagaatgtggtctttggtcactgtcccttgaccccgggtccctgcagcgatcacgatctt
ttcactcgactgccagacaacttttgtctgaatgatccctgtatgggccatggaacctgc
tcgtccagtccagagggatacgaatgtcggtgcacggcacgttactcgggaaaaaattgc
cagaaggacaatggctcgccgtgtgccaaaaatccatgtgagaacggtggttcctgcctg
gagaattcccgaggggattaccagtgcttctgtgatcccaaccacagtggtcagcactgc
gagacggaggtgaacatccacccactctgccagacgaacccctgcctgaacaatggagca
tgtgtggtgattggcggcagtggagcactcacctgcgagtgtcccaaaggatacgctggt
gccaggtgcgaggtggacacggatgagtgcgcctcacagccgtgtcagaacaacggaagc
tgcatagaccgtatcaatggattcagctgcgattgcagcggcaccggttacacgggtgcg
ttctgccagacgaatgtggatgagtgcgacaagaatccgtgcctgaacggcggcagatgc
ttcgatacctacggatggtacacctgccagtgtctggatggttggggcggcgagatttgt
gatcgacccatgacatgccagacgcagcagtgtttgaacggtggcacctgcctggacaag
cccatcggcttccagtgcctctgtccgccggagtacactggtgaactgtgccaaatcgca
cccagttgcgcacagcagtgccccatcgattcggagtgcgtaggcggcaaatgcgtttgt
aagccaggctcatcgggttacaactgtcaaacgagcacgggcgatggagcttctgctttg
gccctgacacccatcaactgcaatgccaccaatggaaagtgtctcaatggaggaacttgc
tccatgaacggaacccactgctattgcgccgtcggctattcgggagatcgttgcgagaag
gccgagaactgttcgccactgaactgccaggaaccgatggtatgtgtccagaatcagtgc
ctctgcccggagaacaaggtgtgcaaccagtgcgccacacaaccgtgccagaatggcggt
gaatgtgtggacctaccgaatggagactacgagtgcaagtgcacccgtggatggactgga
cgcacctgtggcaacgacgtggacgagtgcaccctgcatccgaagatctgcggcaatggt
atctgcaagaacgagaagggatcgtacaaatgctactgtacgcctggatttaccggagtc
cactgcgattccgatgtggacgaatgccttagctttccctgcctcaacggagccacgtgc
cacaacaagataaatgcctacgagtgcgtttgccaaccaggatatgagggagagaactgc
gaagtagatatcgatgagtgcggcagtaatccctgctcgaacggatccacctgcatcgac
aggatcaacaacttcacctgcaactgcattccgggaatgacgggccgcatatgtgacatc
gacattgacgactgtgtgggagatccctgcttgaatggtggtcagtgcatcgaccaattg
ggtggcttccgttgtgactgcagtggcaccggttatgagggcgagaattgtgagctgaac
atagacgaatgcctctcgaatccgtgcacgaatggtgccaagtgcctggacagggttaag
gactacttctgcgattgccacaacggctacaagggaaagaactgtgagcaggacatcaac
gagtgcgagagtaatccctgccagtacaatggcaactgcctagagcgttcgaacataacg
ctttaccaaatgagtaggatcacggatctgcccaaggtgtttagccagccctttagcttt
gagaatgccagcggctacgagtgcgtctgtgtgcccggcatcattggaaagaactgcgag
atcaacattaatgagtgcgacagtaatccatgcagcaagcacggaaattgcaatgacggg
attggaacctatacctgcgaatgcgaacctggcttcgagggcacccactgtgagatcaac
atagatgaatgtgatcgctataatccctgccagaggggcacttgctatgaccagatagac
gactacgactgcgactgcgatgcgaactatggaggcaaaaactgttccgttcttctcaaa
ggctgtgaccagaatccttgtttaaatggcggtgcctgcttgccgtatttgatcaacgag
gtaactcatctgtacaactgcacctgcgagaacggcttccagggcgataaatgcgagaag
accaccactctgtccatggtggccactagcctgatttcggttaccacggaacgcgaggaa
ggctacgacattaatcttcaatttaggaccacactgcccaacggagttttggctttcgga
accaccggcgaaaagaatgaaccagttagctatattttggagctgattaatggacgactg
aatctacattcctcgctcctaaataagtgggagggcgtgtttattggatcgaagctgaac
gatagcaactggcacaaggtgtttgtggccataaacacttcgcatctagtcctttcggcc
aacgacgagcaggctatttttccggttggctcctatgaaacggccaataatagccagcct
tcattcccgcgcacatacctcggaggcaccattcccaatctgaagtcctatctgcgccac
ctcacccaccaaccatcagcttttgtgggctgcatgcaagatataatggtcaatggtaaa
tggatctttcccgatgagcaggatgcgaatatcagttataccaaactggaaaatgtccag
agcggttgtccgcgcaccgaacaatgtaaaccgaatccttgccattcgaacggtgaatgc
acggacctttggcacaccttcgcttgtcactgtcccagaccattctttgggcacacatgt
cagcacaatatgactgctgccacttttggccacgagaacacaacccattcggccgtgatt
gtggagaccacagatgtggctaggcgagctattagatccatcctagacatttccatgttt
attcgtacacgcgagccaactggtcaagtcttttacttgggcactgatccacgcaaagcc
cccactaaaaatattggcgactcatatgtggccgccaaattacacggcggcgagctgctg
gtaaagatgcagttcagcggtactccggaggcctacaccgttggtggccagaaattggac
aacggctataaccacctgatcgaggtggtgcgcaatcaaacgctcgtgcaggtcaagctc
aatggcaccgagtacttccgcaagacgctgtccacgacgggtctgctggacgcacaggtg
ctttacttgggcggacctgcacccacacgcgagtcacttctgggcgcgaccacagaacca
ggaataattccagttccgggagcaggaatacccattgaagacacaacagtgcccaaggag
gcggacgacagcagggactactttaagggcataatccaggacgtgaaggttagcaatggc
tcgctcaacctgattgtggagatgtattccctaaacgtgacagatgtccaagtgaatgcc
aaacctctgggcgctgtaaccatcgatcgtgcctccgtgttacctggtgaggtgtccgat
gatctgtgccgaaagaatccctgcctccataatgccgagtgcaggaacacatggaatgac
tacacttgcaaatgcccaaatggttacaagggaaagaactgccaggagatcgaattttgc
caacacgttacatgtccgggacagagcttgtgccaaaatctggacgatggctatgagtgt
gttacgaacaccacatttactgggcaggaacgcagtcctctcgccttcttctacttccag
gagcagcaatctgacgatattgtcagtgaagcgtctcccaagcaaactcttaaaccggta
attgatattgccttccgcactcgtgctggaggtactctcctgtacatagacaatgtggac
ggattctttgaaattggagtaaacggaggacgagtgaccatcacctggaagctaagtgca
ctgcattttggcgagtctgcacgctttgagaaggagaacactgacggagaatggagtcgc
atttacctcagggcacacaacagcaaactggagggtggatggaagggatgggaatcgatg
gtggatccgacgccagctttttccacggacatcgaccaagcggcctttcagtccctgatc
gctacaagtacccaggtttacttgggtggcatgccagagtcgcgacaagcacgaggatcc
actttgtctgcccagcagggctctcagttcaagggctgtgtgggagaggcaagggtgggc
gatcttttactgccctacttctccatggcggaactgtattcgcgcaccaatgtttcagta
cagcaaaaggctcaattccgtctaaatgccacacgacctgaggagggctgcatcctgtgc
ttccagtcagactgcaaaaatgacggcttctgtcaatctccttcagatgagtacgcctgc
acctgtcagcctggattcgagggcgatgattgcggcacggacatcgacgagtgtcttaac
acggaatgcttgaacaacggcacctgcatcaaccaggttgcagctttcttctgccagtgt
cagccaggattcgagggtcagcactgtgagcaaaacatcgacgagtgtgcggatcagccg
tgccacaacggtggcaactgcacggatcttatcgcatcgtacgtgtgcgactgccctgag
gactatatgggcccgcagtgcgacgtgctgaagcaaatgacctgcgagaacgagccatgt
cggaatggatcaacctgccagaatggattcaatgcttctactggcaataactttacatgt
acatgcgtgcccggcttcgagggtccactgtgtgacatacccttctgtgaaataacgcct
tgcgataacggtggcctctgcctgaccactggagcggtaccgatgtgcaaatgtagtctg
ggatacactggtcgcctgtgcgagcaggacattaacgagtgcgaatcgaatccatgccag
aacggtggtcagtgtaaggacctcgtcggcaggtacgagtgcgattgccagggcaccggg
ttcgagggcattcgctgtgaaaatgacatcgacgagtgcaacatggagggagattactgc
ggcggattgggccggtgtttcaacaagcccggatccttccagtgcatctgccagaaaccc
tattgcggagcctactgcaactttacggatccctgcaacgctacggacctctgctcaaac
ggcggtcgctgcgtagagtcctgcggcgccaaaccggactactactgcgagtgtccggaa
ggtttcgcgggaaagaattgcacagcaccgattacggccaaggaggacgggccttcgacc
acagacattgccatcattgtaatacccgtagtggtggtgctgctgctgatcgcgggagcc
ctcctgggcaccttcctggtgatggccaggaacaagcgagcaaccaggggcacctatagc
ccgagcgcgcaagagtactgcaacccacggctggaaatggacaacgtactgaagccaccg
ccggaagagcgactaatttag

DBGET integrated database retrieval system