KEGG   Drosophila melanogaster (fruit fly): Dmel_CG6518
Entry
Dmel_CG6518       CDS       T00030                                 
Symbol
inaC
Name
(RefSeq) inactivation no afterpotential C
  KO
K02677  classical protein kinase C alpha type [EC:2.7.11.13]
Organism
dme  Drosophila melanogaster (fruit fly)
Pathway
dme04070  Phosphatidylinositol signaling system
dme04150  mTOR signaling pathway
dme04310  Wnt signaling pathway
dme04745  Phototransduction - fly
Brite
KEGG Orthology (KO) [BR:dme00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    Dmel_CG6518 (inaC)
   04070 Phosphatidylinositol signaling system
    Dmel_CG6518 (inaC)
   04150 mTOR signaling pathway
    Dmel_CG6518 (inaC)
 09150 Organismal Systems
  09157 Sensory system
   04745 Phototransduction - fly
    Dmel_CG6518 (inaC)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:dme01001]
    Dmel_CG6518 (inaC)
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:dme04131]
    Dmel_CG6518 (inaC)
Enzymes [BR:dme01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.13  protein kinase C
     Dmel_CG6518 (inaC)
Protein kinases [BR:dme01001]
 Serine/threonine kinases: AGC group
  PKC family [OT]
   Dmel_CG6518 (inaC)
Membrane trafficking [BR:dme04131]
 Endocytosis
  Lipid raft mediated endocytosis
   Caveolin-mediated endocytosis
    Dmel_CG6518 (inaC)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr C1_1 C2 Pkinase_C Haspin_kinase Kinase-like ABC1 zf-RING-like
Other DBs
NCBI-GeneID: 36897
NCBI-ProteinID: NP_476863
FlyBase: FBgn0004784
UniProt: P13677
LinkDB
Position
2R
AA seq 700 aa
MAAAAVATPGATVLPPSVPSAAPGAKAPAAGAGKGPGNLLEITGEANIVNYMKNRLRKGA
MKRKGLEMVNGHRFGVRFFKNPTYCGHCKDFIWGFGKQGFQCEECRFNIHQKCCKFVVFK
CPGKDTDFDADCAKVKHGWISTTYTTPTFCDECGLLLHGVAHQGVKCENCNLNVHHACQE
TVPPMCGADISEVRGKLLLYVELKGNNLKVDIKEAANLIPMDTNGFSDPYIAVQMHPDRS
GRTKKKTKTIQKNLNPVFNETFTFELQPQDRDKRLLIEVWDWDRTSRNDFMGSFSFSLEE
LQKEPVDGWYKFLSQVEGEHYNIPCVDAFNDIARLRDEVRHDRRPNEKRRMDNKDMPHNM
SKRDMIRAADFNFVKVIGKGSFGKVLLAERRGTDELYAVKVLRKDVIIQTDDMELPMNEK
KILALSGRPPFLVSMHSCFQTMDRLFFVMEYCKGGDLMYHMQQYGRFKESVAIFYAVEVA
IALFFLHERDIIYRDLKLDNILLDGEGHVKLVDFGLSKEGVTERQTTRTFCGTPNYMAPE
IVSYDPYSIAADWWSFGVLLFEFMAGQAPFEGDDETTVFRNIKDKKAVFPKHFSVEAMDI
ITSFLTKKPNNRLGAGRYARQEITTHPFFRNVDWDKAEACEMEPPIKPMIKHRKDISNFD
DAFTKEKTDLTPTDKLFMMNLDQNDFIGFSFMNPEFITII
NT seq 2103 nt   +upstreamnt  +downstreamnt
atggctgcggctgctgttgccacaccgggggccactgtgctccctccctcggtgcccagt
gccgctccaggggccaaggctccagcggctggagctggcaaaggtccaggaaatctactg
gagatcactggcgaagcaaatatcgtcaactatatgaagaatcgtctaaggaagggtgcg
atgaagcgaaagggtctcgaaatggtcaatggtcatcgtttcggagttagattctttaag
aatccaacctactgcggtcattgcaaggatttcatctggggctttggcaagcaaggtttt
cagtgcgaggaatgccgcttcaacattcaccagaagtgctgtaaatttgtggtgttcaaa
tgtcctggcaaggacacggacttcgatgccgactgcgctaaggtgaagcacggctggatt
tccaccacctacaccacaccgacattctgcgacgagtgcggactgctgctccatggagtc
gcccatcagggcgtcaagtgcgagaattgcaacctaaatgtgcatcacgcctgccaggag
acagtgccaccgatgtgtggtgcggacatcagcgaggtgaggggtaaactactgctatac
gtcgagcttaagggcaataacttgaaagttgatattaaggaggcagctaacctcattccc
atggataccaacgggtttagcgatccctatattgcagtgcaaatgcatccggaccgttcg
gggcgcaccaaaaagaagaccaagaccattcagaaaaacctcaatccagtgttcaacgag
acttttacttttgagttgcagccgcaggaccgtgacaagcgtttgctcatcgaggtttgg
gattgggatcgaacttctcgcaatgatttcatgggatcgttctcgttcagcctggaggaa
ctgcaaaaggagccagttgatggctggtataagtttctgtcgcaagtggagggtgaacat
tataacataccctgtgtggatgcctttaatgatatagctcgcttaagggatgaagttagg
cacgatcgtcgtccgaatgaaaagcgtcgcatggacaacaaggatatgccgcataatatg
agcaaacgcgatatgattcgagctgctgatttcaactttgttaaagttattggcaaggga
tcctttggcaaagtcctgctggccgagcgtcgtggcacggatgagctgtatgccgtgaag
gtcctgcgaaaggatgtcattatccaaacggacgatatggagctgccaatgaatgagaag
aaaattctagccctatccggacgtcctcctttcctcgtctccatgcactcatgtttccag
actatggaccgattattcttcgtaatggagtactgtaagggtggagatcttatgtaccat
atgcagcagtatggaaggttcaaggagtctgtggctattttttacgctgtggaagtggct
attgctctgtttttcctccacgagcgtgatattatctatagagatctaaagctggacaac
attttgctggatggtgaggggcatgtaaagctggtcgactttggattgagcaaagagggc
gttaccgagcggcagaccacacgaaccttttgtggtactccaaattatatggctcccgaa
attgttagctacgatccgtattccatcgccgctgattggtggtcttttggtgtattgctt
ttcgaattcatggcaggtcaggctccattcgaaggagatgatgaaactactgtctttagg
aacataaaggacaagaaggcggtgtttccaaagcatttcagcgtggaggccatggatata
ataacgagcttcctgaccaaaaagcccaacaatagattgggtgcaggccgctatgccaga
caggagattaccacgcatcctttcttccggaatgtggactgggataaggcagaggcatgc
gaaatggagccacctattaagccaatgattaaacatcgcaaggatataagcaactttgat
gatgcctttaccaaggagaagacggacttaactccaacggacaagctttttatgatgaat
ttggaccagaacgattttatcggattttctttcatgaatcccgagtttataaccatcatt
taa

KEGG   Drosophila melanogaster (fruit fly): Dmel_CG6622
Entry
Dmel_CG6622       CDS       T00030                                 
Symbol
Pkc53E
Name
(RefSeq) protein C kinase 53E, isoform B
  KO
K02677  classical protein kinase C alpha type [EC:2.7.11.13]
Organism
dme  Drosophila melanogaster (fruit fly)
Pathway
dme04070  Phosphatidylinositol signaling system
dme04150  mTOR signaling pathway
dme04310  Wnt signaling pathway
dme04745  Phototransduction - fly
Brite
KEGG Orthology (KO) [BR:dme00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    Dmel_CG6622 (Pkc53E)
   04070 Phosphatidylinositol signaling system
    Dmel_CG6622 (Pkc53E)
   04150 mTOR signaling pathway
    Dmel_CG6622 (Pkc53E)
 09150 Organismal Systems
  09157 Sensory system
   04745 Phototransduction - fly
    Dmel_CG6622 (Pkc53E)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:dme01001]
    Dmel_CG6622 (Pkc53E)
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:dme04131]
    Dmel_CG6622 (Pkc53E)
Enzymes [BR:dme01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.13  protein kinase C
     Dmel_CG6622 (Pkc53E)
Protein kinases [BR:dme01001]
 Serine/threonine kinases: AGC group
  PKC family [OT]
   Dmel_CG6622 (Pkc53E)
Membrane trafficking [BR:dme04131]
 Endocytosis
  Lipid raft mediated endocytosis
   Caveolin-mediated endocytosis
    Dmel_CG6622 (Pkc53E)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr C1_1 C2 Pkinase_C PI3K_C2 ABC1 Haspin_kinase Kinase-like C1_2
Other DBs
NCBI-GeneID: 48311
NCBI-ProteinID: NP_725626
FlyBase: FBgn0003091
UniProt: P05130
LinkDB
Position
2R
AA seq 679 aa
MSEGSDNNGDPQQQGAEGEAVGENKMKSRLRKGALKKKNVFNVKDHCFIARFFKQPTFCS
HCKDFICGYQSGYAWMGFGKQGFQCQVCSYVVHKRCHEYVTFICPGKDKGIDSDSPKTQH
NFEPFTYAGPTFCDHCGSLLYGIYHQGLKCSACDMNVHARCKENVPSLCGCDHTERRGRI
YLEINVKENLLTVQIKEGRNLIPMDPNGLSDPYVKVKLIPDDKDQSKKKTRTIKACLNPV
WNETLTYDLKPEDKDRRILIEVWDWDRTSRNDFMGALSFGISEIIKNPTNGWFKLLTQDE
GEYYNVPCADDEQDLLKLKQKPSQKKPMVMRSDTNTHTSSKKDMIRATDFNFIKVLGKGS
FGKVLLAERKGSEELYAIKILKKDVIIQDDDVECTMIEKRVLALGEKPPFLVQLHSCFQT
MDRLFFVMEYVNGGDLMFQIQQFGKFKEPVAVFYAAEIAAGLFFLHTKGILYRDLKLDNV
LLDADGHVKIADFGMCKENIVGDKTTKTFCGTPDYIAPEIILYQPYGKSVDWWAYGVLLY
EMLVGQPPFDGEDEEELFAAITDHNVSYPKSLSKEAKEACKGFLTKQPNKRLGCGSSGEE
DVRLHPFFRRIDWEKIENREVQPPFKPKIKHRKDVSNFDKQFTSEKTDLTPTDKVFMMNL
DQSEFVGFSYMNPEYVFSP
NT seq 2040 nt   +upstreamnt  +downstreamnt
atgtcggagggcagcgataacaacggggatccccagcagcagggggcggagggggaggcg
gtgggcgagaacaaaatgaagtcccgcctccgcaaaggagccctcaagaagaagaacgtc
ttcaatgtcaaggatcactgcttcatcgcccggttcttcaagcagcccacgttctgctcc
cactgcaaggactttatctgcggctatcagtcgggatatgcatggatgggcttcggaaag
caaggatttcagtgccaagtttgctcctatgtggtgcacaagcggtgccacgaatatgtc
accttcatctgcccgggcaaggataagggcatcgattcggactcaccaaaaactcaacac
aatttcgagccattcacatacgcaggacccacgttctgcgatcattgtgggtccctgctg
tatggcatttaccaccagggtctcaaatgctcagcatgtgacatgaacgtgcatgcccgc
tgcaaggagaacgtgcccagcctttgcggatgcgatcacacggagcggcggggtcgcatt
tatctggagatcaatgtcaaggagaatctgctaactgtccagatcaaggagggtcgcaat
ctcatacccatggacccaaacggactgagcgatccctatgtgaaggtgaagctaattcca
gatgacaaggatcaatccaagaagaagactcgcaccattaaggcttgcctaaatcctgtc
tggaatgagacactcacttatgatctaaagcccgaagacaaggatcgacgcatcctgatc
gaagtgtgggactgggatcgcacttcacgcaatgactttatgggtgctttgtccttcgga
atctcagagatcatcaagaacccaaccaatggctggttcaaactgctcacccaggacgaa
ggcgagtactacaatgtgccatgtgcggatgatgagcaggacctactgaagctcaagcag
aaaccatcgcaaaagaagccgatggtaatgcgcagcgatacgaacacgcatacttcttcc
aaaaaggatatgatccgggccacggactttaatttcatcaaagttctcggcaagggctca
tttggaaaggttttgctggctgagcgcaaaggcagcgaggagttgtatgccattaagata
ctcaaaaaggatgtgatcattcaggacgacgacgtcgagtgcaccatgatcgaaaagcgt
gtcctggcgctgggcgaaaagccacctttcctggtccaattacactcctgctttcagacg
atggaccgtttgttctttgtaatggagtatgtgaatggcggcgatttgatgttccaaatc
caacagtttggcaagtttaaggaaccagtggccgtattttatgccgctgaaatagcagca
ggtcttttcttccttcataccaagggcatactgtatcgagatctaaagctggataatgtg
ctcctagacgccgatggacatgtgaagattgcggactttggcatgtgcaaggagaacata
gtgggtgataagaccacaaagactttctgcggtacacctgattacattgctccagagata
atactgtatcagccctatggcaaatcggtggactggtgggcctatggagtactgctttat
gagatgttagtgggccagccacctttcgatggcgaagatgaggaggagctgtttgccgcc
ataactgatcataatgtgtcctatccaaagagcctgagcaaagaggccaaagaggcctgc
aagggcttcctaactaagcagccaaataagcgtttgggttgtggttcctctggcgaggag
gatgtgcgtctgcatccctttttcagacgcatcgattgggagaaaatcgaaaatcgcgaa
gtgcaaccgccatttaagccgaaaattaaacaccgcaaggatgtgtccaactttgacaag
cagttcacatcagagaaaacagacttgacgcccacggacaaggtgtttatgatgaatctg
gatcagtcggaattcgttggcttctcctacatgaatcccgaatatgttttcagcccatag

DBGET integrated database retrieval system