KEGG   Drosophila melanogaster (fruit fly): Dmel_CG6578
Entry
Dmel_CG6578       CDS       T00030                                 
Symbol
phm
Name
(RefSeq) phantom, isoform B
  KO
K10720  ecdysteroid 25-hydroxylase [EC:1.14.-.-]
Organism
dme  Drosophila melanogaster (fruit fly)
Pathway
dme00981  Insect hormone biosynthesis
Brite
KEGG Orthology (KO) [BR:dme00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00981 Insect hormone biosynthesis
    Dmel_CG6578 (phm)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00199 Cytochrome P450 [BR:dme00199]
    Dmel_CG6578 (phm)
Enzymes [BR:dme01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.-
    1.14.-.-
     Dmel_CG6578 (phm)
Cytochrome P450 [BR:dme00199]
 Cytochrome P450, animal type
  CYP306 family
   Dmel_CG6578 (phm)
SSDB
Motif
Pfam: p450
Other DBs
NCBI-GeneID: 32857
NCBI-ProteinID: NP_001285414
FlyBase: FBgn0004959
UniProt: Q9VWR5 X2JG03
LinkDB
Position
X:18685766..18688433
AA seq 574 aa
MSADIVDIGHTGWMPSVQSLSILLVPGALVLVILYLCERQCNDLMGAPPPGPWGLPFLGY
LPFLDARAPHKSLQKLAKRYGGIFELKMGRVPTVVLSDAALVRDFFRRDVMTGRAPLYLT
HGIMGGFGIICAQEDIWRHARRETIDWLKALGMTRRPGELRARLERRIARGVDECVRLFD
TEAKKSCASEVNPLPALHHSLGNIINDLVFGITYKRDDPDWLYLQRLQEEGVKLIGVSGV
VNFLPWLRHLPANVRNIRFLLEGKAKTHAIYDRIVEACGQRLKEKQKVFKELQEQKRLQR
QLEKEQLRQSKEADPSQEQSEADEDDEESDEEDTYEPECILEHFLAVRDTDSQLYCDDQL
RHLLADLFGAGVDTSLATLRWFLLYLAREQRCQRRLHELLLPLGPSPTLEELEPLAYLRA
CISETMRIRSVVPLGIPHGCKENFVVGDYFIKGGSMIVCSEWAIHMDPVAFPEPEEFRPE
RFLTADGAYQAPPQFIPFSSGYRMCPGEEMARMILTLFTGRILRRFHLELPSGTEVDMAG
ESGITLTPTPHMLRFTKLPAVEMRHAPDGAVVQD
NT seq 1725 nt   +upstreamnt  +downstreamnt
atgtcggcggacatcgtcgatattggccacaccggttggatgccctcggtgcagagcctg
agtattctgctggttccgggtgcgctcgtcctggtgattctctacctgtgcgagcgccag
tgcaatgacctcatgggtgccccaccgccgggtccctggggcctgccctttctgggttac
ctgcccttcctggacgcccgtgcgccgcacaagtcactccagaagctggccaagcggtat
ggtggaattttcgagctgaaaatgggcagggtgccgaccgtagtcctctcggatgccgcc
ttggtgcgggatttctttcggcgcgatgtgatgactggccgtgcgccgctctacctcacc
cacggcatcatgggtggatttggcatcatctgcgcccaggaggacatttggcgacatgca
cggcgcgagactatcgattggctaaaggccttgggcatgacccgtcggccgggggaactg
cgcgcgcggctggagcggcgcatagcccgcggagtcgacgagtgcgtacggcttttcgat
actgaggcaaagaagagctgtgcgtcggaagtgaatccgctgccggcgctccatcactcg
ctgggcaacataatcaacgacctggtcttcgggatcacctacaagcgcgacgaccccgac
tggctgtacctgcagcggctgcaggaggagggcgtcaagctgattggcgtctccggggtg
gtcaactttttgccctggctgcgtcacctgcccgccaacgtgcgcaacatccgcttcctg
ctggagggcaaggccaagacgcacgccatctacgaccgcattgtggaggcctgtggccag
cggctgaaggagaagcagaaggtgttcaaggagctccaggagcagaagcggctgcaaagg
cagctagagaaggagcagctcaggcagtcaaaggaagcggatccaagccaggagcagagt
gaggcagacgaggatgacgaggagagcgatgaggaggacacgtacgagccggagtgcatc
ctggagcacttcctagccgttcgagacacggattcgcagctctactgcgacgaccagctg
cgccatctgctggccgatctctttggagccggggtggacacctcgctggccaccctgcgc
tggttcctgctctacttggcccgcgaacaacgctgccagcggcgcctgcatgagctcctc
ctgccgctgggtccgtctcccactttggaggaactggagccgctggcctacctaagggct
tgcatttccgagacgatgcgcatacgcagcgttgtcccactgggcattccgcacggatgc
aaagagaacttcgtcgtgggcgattattttatcaagggtggttcgatgatcgtttgctcg
gagtgggctatccacatggacccagtggccttcccggaaccggaggagttccgtccggag
cgcttcttgaccgccgatggagcctaccaggcgccgccacagttcatcccattctcgtcc
ggctatcgaatgtgtcccggcgaagagatggctcgcatgatactcacgctctttacgggt
cgcatcctcaggcgcttccacttggaactgccctcgggcactgaggtggacatggcgggt
gagagcggcatcaccctgacccccactccgcacatgctgcgattcaccaagctgccggcg
gtggagatgcgccatgcacccgacggagctgtggtgcaggattag

DBGET integrated database retrieval system